Sequence of POL_SIVSP

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
retroviral ribonuclease H
P19505
Simian immunodeficiency virus (isolate PBj14/BCL-3)
1449
163326
Reaction
Endohydrolysis of RNA in RNA/DNA hybrids. Three different cleavage modes: 1. sequence-specific internal cleavage of RNA. Human immunodeficiency virus type 1 and Moloney murine leukemia virus enzymes prefer to cleave the RNA strand one nucleotide away from the RNA-DNA junction. 2. RNA 5'-end directed cleavage 13-19 nucleotides from the RNA end. 3. DNA 3'-end directed cleavage 15-20 nucleotides away from the primer terminus.
Sequences with same EC No.
Sequence
show sequence in normal format
>P19505|retroviral ribonuclease H|EC 3.1.26.13|Simian immunodeficiency virus (isolate PBj14/BCL-3)|Swiss-Prot
MGARNSVLSGKKADELEKIRLRPGGKKRYQLKHIVWAANELDRFGLAESLLENKEGCQKI
LSVLAPLVPTGSENLKSLYNTVCVLWCIHAEEKVKHTEEAKQIVQRHLVVETGTADKMPA
TSRPTAPPSGKGGNYPVQQIGGNYTHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEG
CTPYDINQMLNCVGEHQAAMQIIREIINEEAADWDLQHPQPGPIPPGQLREPRGSDIAGT
TSTVDEQIQWMYRQQNPIPVGNIYRRWIQLGLQKCVRMYNPTNILDVKQGPKEPFQSYVD
RFYKSLRAEQTDPAVKNWMTQTLLIQNANPDCKLVLKGLGINPTLEEMLTACQGVGGPGQ
KARLMAEALKDALTQGPLPFAAVQQKGQRKIIKCWNCGKEGHSARQCRAPRRQGCWKCGK
AGHVMAKCPERQAGFFRAWPMGKEAPQFPHGPDASGADTNCSPRGSSCGSTEELHEDGQK
AEGEQRETLQGGNGGFAAPQFSLWRRPIVTAYIEEQPVEVLLDTGADDSIVAGIELGPNY
TPKIVGGIGGFINTKEYKDVKIKVLGKVIKGTIMTGDTPINIFGRNLLTAMGMSLNLPIA
KVEPIKVTLKPGKDGPKLRQWPLSKEKIIALREICEKMEKDGQLEEAPPTNPYNTPTFAI
KKKDKNKWRMLIDFRELNKVTQDFTEVQLGIPHPAGLAKRRRITVLDVGDAYFSIPLDEE
FRQYTAFTLPSVNNAEPGKRYIYKVLPQGWKGSPAIFQHTMRNVLEPFRKANPDVTLIQY
MDDILIASDRTDLEHDRVVLQLKELLNSIGFSTPEEKFQKDPPFQWMGYELWPTKWKLQK
IELPQRETWTVNDIQKLVGVLNWAAQIYPGIKTKHLCRLIRGKMTLTEEVQWTEMAEAEY
EENKIILSQEQEGCYYQEGKPLEATVIKSQDNQWSYKIHQEDKILKVGKFAKIKNTHTNG
VRLLAHVVQKIGKEAIVIWGQVPRFHLPVEREIWEQWWTDYWQVTWIPEWDFVSTPPLVR
LVFNLVKEPIQGAETFYVDGSCNRQSREGKAGYVTDRGRDKAKLLEQTTNQQAELEAFYL
ALADSGPKANIIVDSQYVMGIVAGQPTESESRLVNQIIEEMIKKEAIYVAWVPAHKGIGG
NQEVDHLVSQGIRQVLFLEKIEPAQEEHEKYHSNVKELVFKFGLPRLVAKQIVDTCDKCH
QKGEAIHGQVNAELGTWQMDCTHLEGKIIIVAVHVASGFIEAEVIPQETGRQTALFLLKL
ASRWPITHLHTDNGANFTSQEVKMVAWWAGIEQTFGVPYNPQSQGVVEAMNHHLKTQIDR
IREQANSIETIVLMAVHCMNFKRRGGIGDMTPAERLVNMITTEQEIQFQQSKNSKFKNFR
VYYREGRDQLWKGPGELLWKGEGAVILKVGTEIKVVPRRKAKIIKDYGGGKELDSGSHLE
DTGEAREVA
Download this sequence
in fasta format
Download all sequences for 3.1.26.13
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
326015
Dewhurst S.,Embretson J.E.,Anderson D.C.,Mullins J.I.,Fultz P.N.
Sequence analysis and acute pathogenicity of molecularly cloned SIVSMM-PBj14.
Nature
345
636-640
1990
326016
Dewhurst S.,Embretson J.E.,Fultz P.N.,Mullins J.I.
Molecular clones from a non-acutely pathogenic derivative of SIVsmmPBj14: characterization and comparison to acutely pathogenic clones.
AIDS Res. Hum. Retroviruses
8
1179-1187
1992