Sequence of ASPD_BURTA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aspartate dehydrogenase
Q2T559
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
271
27879
Reaction
L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q2T559|aspartate dehydrogenase|EC 1.4.1.21|Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)|Swiss-Prot
MRNAHAPVDVAMIGFGAIGAAVYRAVEHDAALRVAHVIVPEHQCDAVRGALGERVDVVSS
VDALAYRPQFALECAGHGALVDHVVPLLRAGTDCAVASIGALSDLALLDALSEAADEGGA
TLTLLSGAIGGVDALAAAKQGGLDEVQYIGRKPPLGWLGTPAEALCDLRAMTAEQTIFEG
SARDAARLYPKNANVAATVALAGVGLDATKVRLIADPAVTRNVHRVVARGAFGEMSIEMS
GKPLPDNPKTSALTAFSAIRALRNRASHCVI
Download this sequence
in fasta format
Download all sequences for 1.4.1.21
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
128361
Kim H.S.,Schell M.A.,Yu Y.,Ulrich R.L.,Sarria S.H.,Nierman W.C.,DeShazer D.
Bacterial genome adaptation to niches: divergence of the potential virulence genes in three Burkholderia species of different survival strategies.
BMC Genomics
6
174-174
2005