Sequence of TRM14_METJA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tRNA (guanine6-N2)-methyltransferase
Q57880
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
381
43738
Reaction
S-adenosyl-L-methionine + guanine6 in tRNA = S-adenosyl-L-homocysteine + N2-methylguanine6 in tRNA
Sequences with same EC No.
Sequence
show sequence in normal format
>Q57880|tRNA (guanine6-N2)-methyltransferase|EC 2.1.1.256|Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)|Swiss-Prot
MDYYVTLSPGLEKISKNEIESFGGKIKEIRENKGRIFFSGDLKLIPKINYLSRTIERMNI
LLHREEIPNIALDDIYKRVYNIDWTEWIKENQSFAIRPLRAGEHNFTSIDIGRVAGEAVI
KSYQRDKNIRLKVNLDEPDVIVRVEVIFDELIVGIDTTGDIALDKRGYRVFNHPAHLNAT
IASSLVYLSDWKDDEMLLDPMCGSGTIPIEGALMKRNIPPGKFRENKYGFKFIDIFGYEL
LDKIKKEIVENKNIYKIIGLDKNQKYLDGAKDNAKNAEVLDTIEFICGDATKLHEKFNES
DVIIANPPYGIRIGSKRSVKKLYDEFLSSAKEIMHGSSRLIVITAEDKMFKDAIAKNNFE
VKEEFNVMFGGLMTRVFYLTL
Download this sequence
in fasta format
Download all sequences for 2.1.1.256
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
485777
Bult C.J.,White O.,Olsen G.J.,Zhou L.,Fleischmann R.D.,Sutton G.G.,Blake J.A.,FitzGerald L.M.,Clayton R.A.,Gocayne J.D.,Kerlavage A.R.,Dougherty B.A.,Tomb J.-F.,Adams M.D.,Reich C.I.,Overbeek R.,Kirkness E.F.,Weinstock K.G.,Merrick J.M.,Glodek A.,Scott J.L.,Geoghagen N.S.M.,Weidman J.F.,Fuhrmann J.L.,Nguyen D.,Utterback T.R.,Kelley J.M.,Peterson J.D.,Sadow P.W.,Hanna M.C.,Cotton M.D.,Roberts K.M.,Hurst M.A.,Kaine B.P.,Borodovsky M.,Klenk H.-P.,Fraser C.M.,Smith H.O.,Woese C.R.,Venter J.C.
Complete genome sequence of the methanogenic archaeon, Methanococcus jannaschii.
Science
273
1058-1073
1996
485778
Menezes S.,Gaston K.W.,Krivos K.L.,Apolinario E.E.,Reich N.O.,Sowers K.R.,Limbach P.A.,Perona J.J.
Formation of m2G6 in Methanocaldococcus jannaschii tRNA catalyzed by the novel methyltransferase Trm14.
Nucleic Acids Res.
39
7641-7655
2011