Sequence of TRM14_ARCFU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tRNA (guanine6-N2)-methyltransferase
O28105
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
392
44374
Reaction
S-adenosyl-L-methionine + guanine6 in tRNA = S-adenosyl-L-homocysteine + N2-methylguanine6 in tRNA
Sequences with same EC No.
Sequence
show sequence in normal format
>O28105|tRNA (guanine6-N2)-methyltransferase|EC 2.1.1.256|Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)|Swiss-Prot
MKRVQNLLVAVGLSPNYHRRTYPSGKKSLVVRFYATLTPGLEDVAAKEVESFGCKVEEIR
ERRGRIFFSGEKSAIPLLNHFSRTLERLNVLLLRCEVEGLDDIYAAVKGLDFSFVKGKSF
AIRSLRVGEHDFTSMDIARVAGQAVIDSFMESYGERLKVNLNQPDVIIRVELVDSELFVG
VDTTGDDAMHKRWWRVYNHPAHLNAAIACGMLRIADWKVDESLIDPMCGSGTIPIEAALM
VRNVPNLRDFAYKKLCEWELAFEPNEVRLKLYGMEKFRKHLVGAIRNAVNAGVADTIEFR
QGDATEMTGEYDVIITNPPYGLRIHRKGAIERLYHSFARAAKRCMNQNSRLVIITAEHRV
FANAAEEAGLQCTHERFVKYGGLLTKIMVFMI
Download this sequence
in fasta format
Download all sequences for 2.1.1.256
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
485776
Klenk H.-P.,Clayton R.A.,Tomb J.-F.,White O.,Nelson K.E.,Ketchum K.A.,Dodson R.J.,Gwinn M.L.,Hickey E.K.,Peterson J.D.,Richardson D.L.,Kerlavage A.R.,Graham D.E.,Kyrpides N.C.,Fleischmann R.D.,Quackenbush J.,Lee N.H.,Sutton G.G.,Gill S.R.,Kirkness E.F.,Dougherty B.A.,McKenney K.,Adams M.D.,Loftus B.J.,Peterson S.N.,Reich C.I.,McNeil L.K.,Badger J.H.,Glodek A.,Zhou L.,Overbeek R.,Gocayne J.D.,Weidman J.F.,McDonald L.A.,Utterback T.R.,Cotton M.D.,Spriggs T.,Artiach P.,Kaine B.P.,Sykes S.M.,Sadow P.W.,D'Andrea K.P.,Bowman C.,Fujii C.,Garland S.A.,Mason T.M.,Olsen G.J.,Fraser C.M.,Smith H.O.,Woese C.R.,Venter J.C.
The complete genome sequence of the hyperthermophilic, sulphate-reducing archaeon Archaeoglobus fulgidus.
Nature
390
364-370
1997