Sequence of SPEB_STRP1

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
streptopain
P0C0J1
Streptococcus pyogenes serotype M1
398
43130
Reaction
preferential cleavage with hydrophobic residues at P2, P1 and P1'
Sequences with same EC No.
Sequence
show sequence in normal format
>P0C0J1|streptopain|EC 3.4.22.10|Streptococcus pyogenes serotype M1|Swiss-Prot
MNKKKLGVRLLSLLALGGFVLANPVFADQNFARNEKEAKDSAITFIQKSAAIKAGARSAE
DIKLDKVNLGGELSGSNMYVYNISTGGFVIVSGDKRSPEILGYSTSGSFDANGKENIASF
MESYVEQIKENKKLDTTYAGTAEIKQPVVKSLLDSKGIHYNQGNPYNLLTPVIEKVKPGE
QSFVGQHAATGCVATATAQIMKYHNYPNKGLKDYTYTLSSNNPYFNHPKNLFAAISTRQY
NWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALKENFGYNQ
SVHQINRGDFSKQDWEAQIDKELSQNQPVYYQGVGKVGGHAFVIDGADGRNFYHVNWGWG
GVSDGFFRLDALNPSALGTGGGAGGFNGYQSAVVGIKP
Download this sequence
in fasta format
Download all sequences for 3.4.22.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
476394
Kapur V.,Topouzis S.,Majesky M.W.,Li L.L.,Hamrick M.R.,Hamill R.J.,Patti J.M.,Musser J.M.
A conserved Streptococcus pyogenes extracellular cysteine protease cleaves human fibronectin and degrades vitronectin.
Microb. Pathog.
15
327-346
1993
476396
Ferretti J.J.,McShan W.M.,Ajdic D.J.,Savic D.J.,Savic G.,Lyon K.,Primeaux C.,Sezate S.,Suvorov A.N.,Kenton S.,Lai H.S.,Lin S.P.,Qian Y.,Jia H.G.,Najar F.Z.,Ren Q.,Zhu H.,Song L.,White J.,Yuan X.,Clifton S.W.,Roe B.A.,McLaughlin R.E.
Complete genome sequence of an M1 strain of Streptococcus pyogenes.
Proc. Natl. Acad. Sci. U.S.A.
98
4658-4663
2001
476397
Sumby P.,Porcella S.F.,Madrigal A.G.,Barbian K.D.,Virtaneva K.,Ricklefs S.M.,Sturdevant D.E.,Graham M.R.,Vuopio-Varkila J.,Hoe N.P.,Musser J.M.
Evolutionary origin and emergence of a highly successful clone of serotype M1 group A Streptococcus involved multiple horizontal gene transfer events.
J. Infect. Dis.
192
771-782
2005
476398
Tsai P.-J.,Lin Y.-S.,Kuo C.-F.,Lei H.-Y.,Wu J.-J.
Group A Streptococcus induces apoptosis in human epithelial cells.
Infect. Immun.
67
4334-4339
1999
476399
Wang C.C.,Houng H.C.,Chen C.L.,Wang P.J.,Kuo C.F.,Lin Y.S.,Wu J.J.,Lin M.T.,Liu C.C.,Huang W.,Chuang W.J.
Solution structure and backbone dynamics of streptopain: insight into diverse substrate specificity.
J. Biol. Chem.
284
10957-10967
2009