Sequence of Q92119_PROMU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
atrolysin E
Q92119
Protobothrops mucrosquamatus
487
54782
Reaction
Cleavage of Asn3-/-Gln, Ser9-/-His and Ala14-/-Leu bonds in insulin B chain and Tyr14-/-Gln and Thr8-/-Ser in A chain. Cleaves type IV collagen at Ala73-/-Gln in alpha1(IV) and at Gly7-/-Leu in alpha2(IV)
Sequences with same EC No.
Sequence
show sequence in normal format
>Q92119|atrolysin E|EC 3.4.24.44|Protobothrops mucrosquamatus|TrEMBL
PNPASKMIQVLLMTICLAVFPYQGSCIILESGNVDDYEVVYPRKVTALPKGAVQPKYEDA
MQYEFKVNGGAVVLHLEKNKGLFSEDYSETHYSPDGREITTYPSVEDHCYYHGRIHNDAD
STASISACDGLKGYFKLQGETYLIEPLELSDSEAHAVFKYENVEKEDEAPKMCGVTQNWE
SDESIKKASQLYLTPEQQRFPQRYIELAIVVDHGMHTKYSSNFKKIRKRVHQMVSNMNEM
CRPLNIAITLALLDVWSEKDFITVQADAPTTAGLFGDWRERVLLKKKNHDHAQLLTDTNF
ARNTIGWAYVGRMCDEKYSVAVVKDHSSKVFMVAVTMTHELGHNLGMEHDDKDKCKCDTC
IMSPVISDKQSKLFSDCSKDYYQTFLTNDNPQCILNAPLRTDTVSTPVSGNEFLEAGEEC
DCGSPENPCCDAATCKLRPGAQCAEGLCCDQCRFKKKRTICRRARGDNPDDRSTGQSADC
PRNGLYG
Download this sequence
in fasta format
Download all sequences for 3.4.24.44
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
59350121
Huang KFF,Hung CCC,Pan FMM,Chow LPP,Tsugita A,Chiou SHH
Characterization of multiple metalloproteinases with fibrinogenolytic activity from the venom of Taiwan habu (Trimeresurus mucrosquamatus): protein microsequencing coupled with cDNA sequence analysis.
Biochem. Biophys. Res. Commun.
216
223-233
1995