Sequence of IUCD_ECOLX

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-lysine N6-monooxygenase (NADPH)
P11295
Escherichia coli
425
48726
Reaction
L-lysine + NADPH + H+ + O2 = N6-hydroxy-L-lysine + NADP+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>P11295|L-lysine N6-monooxygenase (NADPH)|EC 1.14.13.59|Escherichia coli|Swiss-Prot
MKKSVDFIGVGTGPFNLSIAALSHQIEELDCLFFDEHPHFSWHPGMLVPDCHMQTVFLKD
LVSAVAPTNPYSFVNYLVKHKKFYRFLTSRLRTVSREEFSDYLRWAAEDMNNLYFSHTVE
NIDFDKKRRLFLVQTSQGEYFARNICLGTGKQPYLPPCVKHMTQSCFHASEMNLRRPDLS
GKRITVVGGGQSGADLFLNALRGEWGEAAEINWVSRRNNFNALDEAAFADEYFTPEYISG
FSGLEEDIRHQLLDEQKMTSDGITADSLLTIYRELYHRFEVLRKPRNIRLLPSRSVTTLE
SSGPGWKLLMEHHLDQGRESLESDVVIFATGYRSALPQILPSLMPLITMHDKNTFKVRDD
FTLEWSGPKENNIFVVNASMQTHGIAEPQLSLMAWRSARILNRVMGRDLFDLSMPPALIQ
WRSGT
Download this sequence
in fasta format
Download all sequences for 1.14.13.59
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
301347
Herrero M.,de Lorenzo V.,Neilands J.B.
Nucleotide sequence of the iucD gene of the pColV-K30 aerobactin operon and topology of its product studied with phoA and lacZ gene fusions.
J. Bacteriol.
170
56-64
1988
301349
Stehr M.,Smau L.,Singh M.,Seth O.,Macheroux P.,Ghisla S.,Diekmann H.
Studies with lysine N6-hydroxylase. Effect of a mutation in the assumed FAD binding site on coenzyme affinities and on lysine hydroxylating activity.
Biol. Chem.
380
47-54
1999
301350
de Lorenzo V.,Bindereif A.,Paw B.H.,Neilands J.B.
Aerobactin biosynthesis and transport genes of plasmid ColV-K30 in Escherichia coli K-12.
J. Bacteriol.
165
570-578
1986