Sequence of AROD1_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
arogenate dehydratase
Q9SA96
Arabidopsis thaliana
392
43605
Reaction
L-arogenate = L-phenylalanine + H2O + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9SA96|arogenate dehydratase|EC 4.2.1.91|Arabidopsis thaliana|Swiss-Prot
MALRCFPIWVCPQTTHHRSPLMGLAEFDADKRRRFCLWECSSSASQRAVTAIEGEIPFSR
ELKKSSDELGLTQETQSLSFHRDLSMLPKPLTANSLYSSDGDDSKVRISFQGIPGAYSET
AALKAFPNCETVPCEQFEAAFQAVELWLVDKAVLPIENSVGGSIHRNYDLLLRHRLHIVQ
EVHLPVNHCLLGVPGVKKEDIKCVLSHPQALDQCVNSLNNLGIQRISAKDTATAAQTVSS
SGKIDVGAIASVRAANIYGLDILAENIQDDVNNVTRFLILAREPMIPRTDRPYKTSIVFS
LEEGPGVLFKALAVFALRSINLSKIESRPQRRRPLRVVDGSNNGSAKYFDYLFYIDFEAS
MADTRAQHALGHLQEFASFIRILGCYPMDLVR
Download this sequence
in fasta format
Download all sequences for 4.2.1.91
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
254673
Theologis A.,Ecker J.R.,Palm C.J.,Federspiel N.A.,Kaul S.,White O.,Alonso J.,Altafi H.,Araujo R.,Bowman C.L.,Brooks S.Y.,Buehler E.,Chan A.,Chao Q.,Chen H.,Cheuk R.F.,Chin C.W.,Chung M.K.,Conn L.,Conway A.B.,Conway A.R.,Creasy T.H.,Dewar K.,Dunn P.,Etgu P.,Feldblyum T.V.,Feng J.-D.,Fong B.,Fujii C.Y.,Gill J.E.,Goldsmith A.D.,Haas B.,Hansen N.F.,Hughes B.,Huizar L.,Hunter J.L.,Jenkins J.,Johnson-Hopson C.,Khan S.,Khaykin E.,Kim C.J.,Koo H.L.,Kremenetskaia I.,Kurtz D.B.,Kwan A.,Lam B.,Langin-Hooper S.,Lee A.,Lee J.M.,Lenz C.A.,Li J.H.,Li Y.-P.,Lin X.,Liu S.X.,Liu Z.A.,Luros J.S.,Maiti R.,Marziali A.,Militscher J.,Miranda M.,Nguyen M.,Nierman W.C.,Osborne B.I.,Pai G.,Peterson J.,Pham P.K.,Rizzo M.,Rooney T.,Rowley D.,Sakano H.,Salzberg S.L.,Schwartz J.R.,Shinn P.,Southwick A.M.,Sun H.,Tallon L.J.,Tambunga G.,Toriumi M.J.,Town C.D.,Utterback T.,Van Aken S.,Vaysberg M.,Vysotskaia V.S.,Walker M.,Wu D.,Yu G.,Fraser C.M.,Venter J.C.,Davis R.W.
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature
408
816-820
2000
254674
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017
254675
Yamada K.,Lim J.,Dale J.M.,Chen H.,Shinn P.,Palm C.J.,Southwick A.M.,Wu H.C.,Kim C.J.,Nguyen M.,Pham P.K.,Cheuk R.F.,Karlin-Newmann G.,Liu S.X.,Lam B.,Sakano H.,Wu T.,Yu G.,Miranda M.,Quach H.L.,Tripp M.,Chang C.H.,Lee J.M.,Toriumi M.J.,Chan M.M.,Tang C.C.,Onodera C.S.,Deng J.M.,Akiyama K.,Ansari Y.,Arakawa T.,Banh J.,Banno F.,Bowser L.,Brooks S.Y.,Carninci P.,Chao Q.,Choy N.,Enju A.,Goldsmith A.D.,Gurjal M.,Hansen N.F.,Hayashizaki Y.,Johnson-Hopson C.,Hsuan V.W.,Iida K.,Karnes M.,Khan S.,Koesema E.,Ishida J.,Jiang P.X.,Jones T.,Kawai J.,Kamiya A.,Meyers C.,Nakajima M.,Narusaka M.,Seki M.,Sakurai T.,Satou M.,Tamse R.,Vaysberg M.,Wallender E.K.,Wong C.,Yamamura Y.,Yuan S.,Shinozaki K.,Davis R.W.,Theologis A.,Ecker J.R.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science
302
842-846
2003
254676
Cho M.-H.,Corea O.R.A.,Yang H.,Bedgar D.L.,Laskar D.D.,Anterola A.M.,Moog-Anterola F.A.,Hood R.L.,Kohalmi S.E.,Bernards M.A.,Kang C.,Davin L.B.,Lewis N.G.
Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.
J. Biol. Chem.
282
30827-30835
2007
254677
Rippert P.,Puyaubert J.,Grisollet D.,Derrier L.,Matringe M.
Tyrosine and phenylalanine are synthesized within the plastids in Arabidopsis.
Plant Physiol.
149
1251-1260
2009