Sequence of Q5KVX7_GEOKA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
Q5KVX7
Geobacillus kaustophilus (strain HTA426)
270
30278
Reaction
5-enolpyruvoyl-6-hydroxy-2-succinylcyclohex-3-ene-1-carboxylate = (1R,6R)-6-hydroxy-2-succinylcyclohexa-2,4-diene-1-carboxylate + pyruvate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5KVX7|2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase|EC 4.2.99.20|Geobacillus kaustophilus (strain HTA426)|TrEMBL
MTMMVNGVCYHAEQYGEGEPLLLLHGFTGSADTWRPLAPFWPDFRVMAVDLLGHGRTEAP
KDARRYRIEHAAADLAALLDEWGVEQVNVLGYSMGGRLALAFAVWHPRRVRRLVLESSSP
GLETEEERRARREADEALARKIETEGVRAFVDDWEKIPLFATQQTLPDPVRAAIRRERLR
HTATGLANSLRGMGTGVQPSFWERLGELAMPVLLVCGERDEKFCRIAAQMHERLPNSELI
CVKGAGHAIHVEQPGIFAKIVSEFMTKGEV
Download this sequence
in fasta format
Download all sequences for 4.2.99.20
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
3493186
Takami H.,Takaki Y.,Chee G.J.,Nishi S.,Shimamura S.,Suzuki H.,Matsui S.,Uchiyama I.
Thermoadaptation trait revealed by the genome sequence of thermophilic Geobacillus kaustophilus.
Nucleic Acids Res.
32
6292-6303
2004