Sequence of SMYD2_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
[histone H3]-lysine4 N-trimethyltransferase
Q0P585
Bos taurus
433
49860
Reaction
3 S-adenosyl-L-methionine + a [histone H3]-L-lysine4 = 3 S-adenosyl-L-homocysteine + a [histone H3]-N6,N6,N6-trimethyl-L-lysine4
Sequences with same EC No.
Sequence
show sequence in normal format
>Q0P585|[histone H3]-lysine4 N-trimethyltransferase|EC 2.1.1.354|Bos taurus|Swiss-Prot
MRAEGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVSERGNHCEFCFARKE
GLSKCGRCKQAFYCNVECQREDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKRDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLNDPPKAETIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSCVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
RYGQKIIQPYSKHYPLYSLNVASMWLKLGRLYMGLENKAAGERALKKAIAIMEVAHGKDH
PYISEIKQEIESH
Download this sequence
in fasta format
Download all sequences for 2.1.1.354
in fasta format
in csv (Excel, OpenOffice) format