Sequence of A0A367A5D1_9ACTN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
crotonyl-CoA carboxylase/reductase
A0A367A5D1
Blastococcus sp. TF02A-26
443
48946
Reaction
(2S)-ethylmalonyl-CoA + NADP+ = (E)-but-2-enoyl-CoA + CO2 + NADPH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A367A5D1|crotonyl-CoA carboxylase/reductase|EC 1.3.1.85|Blastococcus sp. TF02A-26|TrEMBL
MDQIRDAILADQLSDIGGLPVPESYRAVVVRKDEQNMFEGMATRDKDPRKSLHVQEVATP
ELGPGEAIVAVMASSVNYNTVWTSIFEPVSTFGFLERYGRVSELTKRHDLPYHVVGSDLA
GVVLKVGPGVNKWKAGDEVVAHCLSVELEDPAGHDDTMMDPQQRIWGFETNFGGLAELAL
VKSNQLMPKPAHLSWEEAASPGLVNSTAYRQLVSKNGANMKQGDTVLIWGASGGLGSYAT
QMALNGGAIPVCVVSSPEKAEIVRKMGAELVIDRSAEQYRFWKDEQTQDPKEWQRFGKKI
RELTGGEDVDIVFEHPGRETFGASVYVAKKGGTIITCASTTGYLHEYDNRYLWMNLKKIL
SSHFANYKEAWEANRLIDKGLIHPTLSKVYPMEEVGQAALDVHRNAHQGKVGVLTLAPEE
GLGVKDTEKREKHIEAINRFRGV
Download this sequence
in fasta format
Download all sequences for 1.3.1.85
in fasta format
in csv (Excel, OpenOffice) format