Sequence of PAG15_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
lysophospholipase
Q675A5
Rattus norvegicus
413
47391
Reaction
2-lysophosphatidylcholine + H2O = glycerophosphocholine + a carboxylate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q675A5|lysophospholipase|EC 3.1.1.5|Rattus norvegicus|Swiss-Prot
MDRHLCICREIQLRSGLLFPFLLLMMLADLALPAQRHPPVVLVPGDLGNQLEAKLDKPKV
VHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGE
TFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEM
IEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQ
DIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGD
GTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP
Download this sequence
in fasta format
Download all sequences for 3.1.1.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
196185
Abe A.,Hiraoka M.,Wild S.,Wilcoxen S.E.,Paine R.,Shayman J.A.
Lysosomal phospholipase A2 is selectively expressed in alveolar macrophages.
J. Biol. Chem.
279
42605-42611
2004
196187
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Genome Res.
14
2121-2127
2004