Sequence of A0A0M8K8B6_9CHLR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
homoisocitrate dehydrogenase
A0A0M8K8B6
Ardenticatena maritima
332
34777
Reaction
(1R,2S)-1-hydroxybutane-1,2,4-tricarboxylate + NAD+ = 2-oxoadipate + CO2 + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0M8K8B6|homoisocitrate dehydrogenase|EC 1.1.1.87|Ardenticatena maritima|TrEMBL
MTTPTLVLIPGDGIGQEVVPEAARVLQAVMPALHLVEAEAGWGAFQRHGVSVPPATLDAI
RQAGAALFGAVQSPARKVAGYRSAILTMRQALDLYANVRPVHSLPLPNARPHVNLLIVRE
NTEGLYVGEETSDGETVTAQRRITRRASARIGRVAAHLARQRLTIVHKANILPVSDGLFR
DTVRAVVAETRPDLAVDELLVDVAAYHLARTPERFDTLVAPNLYGDILSDLAAVWCGGLG
LAPSINLGDGVAVAEPVHGSAPDIAGKGIANPIAAILSGALLCRYVWRNESAASAIEQAV
ATALQRGAATPDLGGTLSTREMTDAVLAALGA
Download this sequence
in fasta format
Download all sequences for 1.1.1.87
in fasta format
in csv (Excel, OpenOffice) format