Sequence of A0A1R0MJQ8_CHRVL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NAD(P)+ transhydrogenase (Re/Si-specific)
A0A1R0MJQ8
Chromobacterium violaceum
387
39766
Reaction
NADPH + NAD+ = NADP+ + NADH
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1R0MJQ8|NAD(P)+ transhydrogenase (Re/Si-specific)|EC 1.6.1.2|Chromobacterium violaceum|TrEMBL
MNIVIPAERLAGEHRVAATPDTVKKLVAAGHAVTVEQGAGLAAALPDAAFLAAGAGIAEQ
RQAMLAAADIVLAVRMPEAADAAALKPGAVLIGMLAPYQNPLLPQLAAQRVSAFALELLP
RTTRAQSMDVLSSQNNIAGYKAVLLAGQFYPRFMPMLMTAAGTVKAAKALVLGVGVAGLQ
AIATAKRLGAVVEAYDVRPATREQVESLGAKFVEVPMSDEEKAASGGVYAREMSADFQAR
QNALIAQRAAAADIVITTALIPGKPAPRLLSAEAVAGMKPGSVIVDLAAEAGGNCELTRA
GEACLSPNGVHLVGLTNLPAMLAADASSLYARNLHTFLGLLLTPEGLKIDLEDDLVAATL
IAHQGEQRFGAAARPAAANHDKEPQHG
Download this sequence
in fasta format
Download all sequences for 1.6.1.2
in fasta format
in csv (Excel, OpenOffice) format