Sequence of A0A4J2GWY5_STREE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
nucleoside-triphosphate diphosphatase
A0A4J2GWY5
Streptococcus pneumoniae
323
36326
Reaction
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A4J2GWY5|nucleoside-triphosphate diphosphatase|EC 3.6.1.19|Streptococcus pneumoniae|TrEMBL
MTNKIYEYKDDQDWYVGSYSIFGGVNSLSDYKTDFPLFEFSKIFGDEEYGFPLSVTVLRF
GSTYRLFSFVVDMLNQEMGRNLEVIQRHGALLLVENGQLLYVELPKEGVNVHDFFETSKV
RETLLIATRNEGKTKEFRAIFDKLGYDVENLNDYPDLPEVAETGMTFEENARLKAETISQ
LTGKMVLADDSGLKVDVLGGLPGVWSARFAGVGATDRENNAKLLHELAMVFELKDRSAQF
HTTLVVASPNKESLVVEADWSGYINFEPKGENGFGYDPLFLVGETGESSAELTLEEKNSQ
SHRALAVKKLLEVFPSWQSKPSL
Download this sequence
in fasta format
Download all sequences for 3.6.1.19
in fasta format
in csv (Excel, OpenOffice) format