Sequence of A0A0N9Y8T1_MYCFO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
arsenite methyltransferase
A0A0N9Y8T1
Mycobacterium fortuitum
262
27584
Reaction
S-adenosyl-L-methionine + arsenite = S-adenosyl-L-homocysteine + methylarsonate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0N9Y8T1|arsenite methyltransferase|EC 2.1.1.137|Mycobacterium fortuitum|TrEMBL
MPDPQPTNWAAGRYQSVAERISVIAREVVAAAERLQPVRGTALADLACGTGSAALAAAEA
GAEVTGVDFTPELIAIAAERPGADAVRWVVADASDTGLPDGAFATVVSNMGIIFVEPTSL
VAEVGRLLAPGGVFAFSTWVRDEAGSPFFTPIVETLGQPPASGYSPDQWGDLDVVHSRLA
DRFHDVRFETGSHTWAFDSVESAVRFIADESPMHVDLLGRLDEATRDRLLDAFTAALSAA
TNAEGRVSFEAPYAVVTARKNG
Download this sequence
in fasta format
Download all sequences for 2.1.1.137
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
2222737
Costa K.C.,Bergkessel M.,Saunders S.,Korlach J.,Newman D.K.
Enzymatic Degradation of Phenazines Can Generate Energy and Protect Sensitive Organisms from Toxicity.
MBio
6
0-0
2015