Sequence of AUD_PHACH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ascopyrone tautomerase
P84193
Phanerochaete chrysosporium
900
98746
Reaction
1,5-anhydro-4-deoxy-D-glycero-hex-3-en-2-ulose = 1,5-anhydro-4-deoxy-D-glycero-hex-1-en-3-ulose
Sequences with same EC No.
Sequence
show sequence in normal format
>P84193|ascopyrone tautomerase|EC 5.3.2.7|Phanerochaete chrysosporium|Swiss-Prot
MYSKVFLKPHCEPEQPAALPLFQPQLVQGGRPDGYWVEAFPFRSDSSKCPNIIGYGLGTY
DMKSDIQMLVNPYATTNNQSSSWTPVPLAKLDFPVAMHYADITKNGFNDVIITDQYGSSM
DDIWAYGGRVSWLENPGELRDNWTMRTIGHSPGMHRLKAGHFTRTDRVQVVAVPIVVASS
DLTTPADVIIFTAPDDPRSEQLWQRDVVGTRHLVHEVAIVPAAETDGEMRFDQIILAGRD
GVDCLWYDGARWQRHLVGTGLPEERGDPYWGAGSAAVGRVGDDYAGYICSAEAFHGNTVS
VYTKPAGSPTGIVRAEWTRHVLDVFGPLNGKHTGSIHQVVCADIDGDGEDEFLVAMMGAD
PPDFQRTGVWCYKLVDRTNMKFSKTKVSSVSAGRIATANFHSQGSEVDIATISYSVPGYF
ESPNPSINVFLSTGILAERLDEEVMLRVVRAGSTRFKTEMEFLDVAGKKLTLVVLPPFAR
LDVERNVSGVKVMAGTVCWADENGKHERVPATRPFGCESMIVSADYLESGEEGAILVLYK
PSSTSGRPPFRSMDELVAHNLFPAYVPDSVRAMKFPWVRCADRPWAHGRFKDLDFFNLIG
FHVNFADDSAAVLAHVQLWTAGIGVSAGFHNHVEASFCEIHACIANGTGRGGMRWATVPD
ANFNPDSPNLEDTELIVVPDMHEHGPLWRTRPDGHPLLRMNDTIDYPWHAWLAGAGNPSP
QAFDVWVAFEFPGFETFSTPPPPRVLEPGRYAIRFGDPHQTASLALQKNDATDGTPVLAL
LDLDGGPSPQAWNISHVPGTDMYEIAHAKTGSLVCARWPPVKNQRVAGTHSPAAMGLTSR
WAVTKNTKGQITFRLPEAPDHGPLFLSVSAIRHQQEADAIPVIVQGDSIELSAWSLVPAN
Download this sequence
in fasta format
Download all sequences for 5.3.2.7
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
888303
Claesson M.,Lindqvist Y.,Madrid S.,Sandalova T.,Fiskesund R.,Yu S.,Schneider G.
Crystal structure of bifunctional aldos-2-ulose dehydratase/isomerase from Phanerochaete chrysosporium with the reaction intermediate ascopyrone M.
J. Mol. Biol.
417
279-293
2012
888305
Yu S.
Enzymatic description of the anhydrofructose pathway of glycogen degradation II. Gene identification and characterization of the reactions catalyzed by aldos-2-ulose dehydratase that converts 1,5-anhydro-d-fructose to microthecin with ascopyrone M as the intermediate.
Biochim. Biophys. Acta
1723
63-73
2005