Sequence of A0A1C6FNU1_9CLOT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NADH peroxidase
A0A1C6FNU1
uncultured Clostridium sp
181
20001
Reaction
NADH + H+ + H2O2 = NAD+ + 2 H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1C6FNU1|NADH peroxidase|EC 1.11.1.1|uncultured Clostridium sp|TrEMBL
MKKFVCTICGYIHEGEMPPEVCPICKAPASKFEEMKGEMTWADEHRIGVAQGVDPEVVEG
LRANFVGECTEVGMYLAMSRQADREGYPEVAEAYKRIAFEEAEHAAKFAELLGEVVVADT
QANLKARVEAEYGATDGKLKLAKKAKELGLDAIHDTVHEMCKDEARHGKAFLGLLNRHFG
K
Download this sequence
in fasta format
Download all sequences for 1.11.1.1
in fasta format
in csv (Excel, OpenOffice) format