Sequence of A0A406NBB9_9ZZZZ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
(5R)-carbapenem-3-carboxylate synthase
A0A406NBB9
compost metagenome
586
66244
Reaction
(3S,5S)-carbapenam-3-carboxylate + 2-oxoglutarate + O2 = (5R)-carbapen-2-em-3-carboxylate + succinate + CO2 + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A406NBB9|(5R)-carbapenem-3-carboxylate synthase|EC 1.14.20.3|compost metagenome|TrEMBL
MQHKDTWIKAVSDVLAGYLLKDGDDRFETAGRANLAISLACFYDQQAPVRLVLPGFPCKS
PNARDQTFGVLPDYGEAMAIERLDQLGQEIAALHAPGCVVSILSDGTTFNDIVGVPDEVR
RTYNQALRELCTTHTINWVSMEDLFPQASSADAVRATLVKQARLPWKNVEALIAQSRHDE
TLSHAHDKLCSHLYNDLRLCREAGQSEDEHLLQIGYKAYQMMFRGQALNAAVNRFFPDDI
RLSVHQYDNAGPKFTLALADGLSRVSSPWHAVPVRHLDGSQTLRGRAEVDIDKHVLVQYQ
GWPWLYHETLGESLQEFEFELQKRPLFGLLVRDPLGLGFERFSTQLLEALVETFGFVCLR
GCSFDDRDSFARDCERFGTIYQWAFGKVHVVKPADKPEGVVHSLEKTPLHWDLNMLPSSD
AQVQRDPKFCASKFMLYCKTPPQAGEGQTTIVDSRNALRKVGNQVARQWQTVDITYYTRM
TYFGGSPRSYSLVDLHPRTGERILRYQEGTDSTLQTLSQEVQGFEAQAQQALLEQLNALA
YDEDCLIAHEWAEGDLVLIDNYQTLHGRLPMSPASASRELWRVQVY
Download this sequence
in fasta format
Download all sequences for 1.14.20.3
in fasta format
in csv (Excel, OpenOffice) format