Sequence of ASPD_CUPTR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aspartate dehydrogenase
B3R8S4
Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)
266
27799
Reaction
L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>B3R8S4|aspartate dehydrogenase|EC 1.4.1.21|Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)|Swiss-Prot
MLHVSMVGCGAIGRGVLELLKSDPDVVFDVVIVPEHTMDEARGAVSALAPRARVATHLDD
QRPDLLVECAGHHALEEHIVPALERGIPCMVVSVGALSEPGMAERLEAAARRGGTQVQLL
SGAIGAIDALAAARVGGLDEVIYTGRKPARAWTGTPAEQLFDLEALTEATVIFEGTARDA
ARLYPKNANVAATVSLAGLGLDRTAVKLLADPHAVENVHHVEARGAFGGFELTMRGKPLA
ANPKTSALTVFSVVRALGNRAHAVSI
Download this sequence
in fasta format
Download all sequences for 1.4.1.21
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
128363
Amadou C.,Pascal G.,Mangenot S.,Glew M.,Bontemps C.,Capela D.,Carrere S.,Cruveiller S.,Dossat C.,Lajus A.,Marchetti M.,Poinsot V.,Rouy Z.,Servin B.,Saad M.,Schenowitz C.,Barbe V.,Batut J.,Medigue C.,Masson-Boivin C.
Genome sequence of the beta-rhizobium Cupriavidus taiwanensis and comparative genomics of rhizobia.
Genome Res.
18
1472-1483
2008