Sequence of AMPN_CHICK

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aminopeptidase Ey
O57579
Gallus gallus
972
109132
Reaction
differs from other aminopeptidases in broad specificity for amino acids in the P1 position and the ability to hydrolyse peptides of four or five residues that contain Pro in the P1' position
Sequences with same EC No.
Sequence
show sequence in normal format
>O57579|aminopeptidase Ey|EC 3.4.11.20|Gallus gallus|Swiss-Prot
MAAGFFISKSVGIVGIVLALGAVATIIALSVVYAQEKNKSSGGSGGSDTTSTTTASTTTT
STTTASTTAAPNNPWNRWRLPTALKPESYEVTLQPFLTPDDNNMYIFKGNSSVVFLCEEA
TDLILIHSNKLNYTLQGGFHASLHAVNGSTPPTISNTWLETNTQYLVLQLAGPLQQGQHY
RLFSIFTGELADDLAGFYRSEYTEGNVTKVVATTQMQAPDARKAFPCFDEPAMKAVFTVT
MIHPSDHTAISNMPVHSTYQLQMDGQSWNVTQFDPTPRMSTYLLAFIVSQFDYVENNTGK
VQIRIWGRPAAIAEGQGEYALEKTGPILSFFERHYNTAYPLPKSDQVGLPDFNAGAMENW
GLVTYRENSLLYDNAYSSIGNKERVVTVIAHELAHQWFGNLVTLRWWNDLWLNEGFASYV
EYLGADSAEPTWDIKDLMVLNELYTVMATDALTTSHPLTFREDEINTPAQISEVFDSIAY
SKGASVLRMLSDFLTEDVFKEGLQSYLHDFSYNNTVYTDLWDHLQEAVNKNSVPLPDSIG
AIMDRWTLQMGFPVVTVNTLTGSVQQSHFLLDSNSTVERPSVFNYTWIVPITWMTPSRTG
DRYWLVDVSATNSDFSVGSSTWLLLNLNVSGYFRVNYNQENWDQLLQQLSNNHQAIPVIN
RAQIIDDAFNLARAQQVSVTLALNTTRFLSGETAYMPWQAALNNLQYFQLMFDRSEVFGA
MTKYIQKQVTPLFEYYRTATNNWTAIPSALMDQYNEINAISTACSYGIAECQQLATALYQ
QWRQNVSNNPIAPNLRSAIYCSAVATGGEEVWDFIWERFLEAPVVSEADKLRTALTCSTE
TWILQRYLQYTIDPTKIRKQDATSTINSIASNVVGQPLAWDFIRSNWRTLFGQYGGGSFS
FSRLISAVTQRFNTEFELKQLEQFKADNQDIGFGSGTRALEQALERTRTNINWVKENKEV
VHAWFRAETASS
Download this sequence
in fasta format
Download all sequences for 3.4.11.20
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
132027
Midorikawa T.,Abe R.,Yamagata Y.,Nakajima T.,Ichishima E.
Isolation and characterization of cDNA encoding chicken egg yolk aminopeptidase Ey.
Comp. Biochem. Physiol.
119
513-520
1998
132029
Hillier L.W.,Miller W.,Birney E.,Warren W.,Hardison R.C.,Ponting C.P.,Bork P.,Burt D.W.,Groenen M.A.M.,Delany M.E.,Dodgson J.B.,Chinwalla A.T.,Cliften P.F.,Clifton S.W.,Delehaunty K.D.,Fronick C.,Fulton R.S.,Graves T.A.,Kremitzki C.,Layman D.,Magrini V.,McPherson J.D.,Miner T.L.,Minx P.,Nash W.E.,Nhan M.N.,Nelson J.O.,Oddy L.G.,Pohl C.S.,Randall-Maher J.,Smith S.M.,Wallis J.W.,Yang S.-P.,Romanov M.N.,Rondelli C.M.,Paton B.,Smith J.,Morrice D.,Daniels L.,Tempest H.G.,Robertson L.,Masabanda J.S.,Griffin D.K.,Vignal A.,Fillon V.,Jacobbson L.,Kerje S.,Andersson L.,Crooijmans R.P.,Aerts J.,van der Poel J.J.,Ellegren H.,Caldwell R.B.,Hubbard S.J.,Grafham D.V.,Kierzek A.M.,McLaren S.R.,Overton I.M.,Arakawa H.,Beattie K.J.,Bezzubov Y.,Boardman P.E.,Bonfield J.K.,Croning M.D.R.,Davies R.M.,Francis M.D.,Humphray S.J.,Scott C.E.,Taylor R.G.,Tickle C.,Brown W.R.A.,Rogers J.,Buerstedde J.-M.,Wilson S.A.,Stubbs L.,Ovcharenko I.,Gordon L.,Lucas S.,Miller M.M.,Inoko H.,Shiina T.,Kaufman J.,Salomonsen J.,Skjoedt K.,Wong G.K.-S.,Wang J.,Liu B.,Wang J.,Yu J.,Yang H.,Nefedov M.,Koriabine M.,Dejong P.J.,Goodstadt L.,Webber C.,Dickens N.J.,Letunic I.,Suyama M.,Torrents D.,von Mering C.,Zdobnov E.M.,Makova K.,Nekrutenko A.,Elnitski L.,Eswara P.,King D.C.,Yang S.-P.,Tyekucheva S.,Radakrishnan A.,Harris R.S.,Chiaromonte F.,Taylor J.,He J.,Rijnkels M.,Griffiths-Jones S.,Ureta-Vidal A.,Hoffman M.M.,Severin J.,Searle S.M.J.,Law A.S.,Speed D.,Waddington D.,Cheng Z.,Tuzun E.,Eichler E.,Bao Z.,Flicek P.,Shteynberg D.D.,Brent M.R.,Bye J.M.,Huckle E.J.,Chatterji S.,Dewey C.,Pachter L.,Kouranov A.,Mourelatos Z.,Hatzigeorgiou A.G.,Paterson A.H.,Ivarie R.,Brandstrom M.,Axelsson E.,Backstrom N.,Berlin S.,Webster M.T.,Pourquie O.,Reymond A.,Ucla C.,Antonarakis S.E.,Long M.,Emerson J.J.,Betran E.,Dupanloup I.,Kaessmann H.,Hinrichs A.S.,Bejerano G.,Furey T.S.,Harte R.A.,Raney B.,Siepel A.,Kent W.J.,Haussler D.,Eyras E.,Castelo R.,Abril J.F.,Castellano S.,Camara F.,Parra G.,Guigo R.,Bourque G.,Tesler G.,Pevzner P.A.,Smit A.,Fulton L.A.,Mardis E.R.,Wilson R.K.
Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution.
Nature
432
695-716
2004
132032
Tanaka T.,Ichishima E.
Substrate specificity of aminopeptidase Ey from hen's (Gallus domesticus) egg yolk.
Comp. Biochem. Physiol.
105
105-110
1993
132033
Tanaka T.,Ichishima E.
Molecular properties of aminopeptidase Ey as a zinc-metalloenzyme.
Int. J. Biochem.
25
1681-1688
1993
132034
Tanaka T.,Ichishima E.
Inactivation of chemotactic peptides by aminopeptidase Ey from hen's (Gallus gallus domesticus) egg yolk.
Comp. Biochem. Physiol.
107B
533-538
1994