Sequence of AMPN_CANLF

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
membrane alanyl aminopeptidase
P79143
Canis lupus familiaris
975
110257
Reaction
Release of an N-terminal amino acid, Xaa-/-Yaa- from a peptide, amide or arylamide. Xaa is preferably Ala, but may be most amino acids including Pro (slow action). When a terminal hydrophobic residue is followed by a prolyl residue, the two may be released as an intact Xaa-Pro dipeptide
Sequences with same EC No.
Sequence
show sequence in normal format
>P79143|membrane alanyl aminopeptidase|EC 3.4.11.2|Canis lupus familiaris|Swiss-Prot
MAKGFYISKALGILAIVLGIAAVSTIIALSVVYAQEKNKNAESSPVSSPVSSPVSSPVSP
TNPSTTAATTLAQSKPWNHYRLPKTLIPSSYNVTLRPYLTPNSNGLYTFKGSSTVRFTCK
ESTSMIIIHSKKLNYTNIQGQRVALRGVGGSQAPAIDRTELVEVTEYLVVHLREPLQVNS
QYEMDSKFEGELADDLAGFYRSEYTENGVKKVLATTQMQAADARKSFPCFDEPAMKATFN
ITLIHPSNLVALSNMLPRGPSVPFTEEPNWNVTEFETTPIMSTYLLAYIVSEFKNVQENT
PSNVLIRIWARPSAMDQGHGNYALRVTGPILDFFSRHYDTPYPLNKSDQIALPDFNAGAM
ENWGLVTYRESALLYDPQSSSIGNKERVVTVIAHELAHQWFGNLVTLEWWNDLWLNEGFA
SYVEYLGADYAEPTWNLKDLIVLNEVYRVMAVDALASSHPLSSPASEVNTPAQISEVFDS
ISYSKGASVLRMLSSFLTEDLFKKGVASYLHTFAYQNTIYLDLWNHLQWALGNQTAINLP
YTVNAIMDRWILQMGFPVVTVDTTTGTLSQKHFLLDPQSNVTRPSKFNYLWIIPISSVKS
GTQQAHYWMPDNAKVQNDLFKTTGDEWVLLNLNVTGYYLVNYDQNNWKKIHTQLQTDLSV
IPVINRAQVIHDTFDLASAQIVPVTLALNSTLFLNQETEYMPWEAALSSLSYFKLMFDRS
EVYGPMKNYLRKQVTPLFNHFEKITQNWTDHPQTLTEQYNEINAVSTACTYGVPKCKDLV
STLFAEWRKNPQNNPIYPNLRSTVYCNAIAQGGEEEWNFVWEQFRNTSLVNEADKLRSAL
ACSTQVWILNRYLSYTLNPEFIRKQDVISTLSSIASNVIGQSLAWDFIQSNWKKLFEDYG
TGSFSFSNLIQAVTRRFSTEFELQQLEQFKANNMDTGFGSGTRALEQALEKTKANIKWVK
ENKEAVLQWFRENSQ
Download this sequence
in fasta format
Download all sequences for 3.4.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
132023
Lindblad-Toh K.,Wade C.M.,Mikkelsen T.S.,Karlsson E.K.,Jaffe D.B.,Kamal M.,Clamp M.,Chang J.L.,Kulbokas E.J. III,Zody M.C.,Mauceli E.,Xie X.,Breen M.,Wayne R.K.,Ostrander E.A.,Ponting C.P.,Galibert F.,Smith D.R.,deJong P.J.,Kirkness E.F.,Alvarez P.,Biagi T.,Brockman W.,Butler J.,Chin C.-W.,Cook A.,Cuff J.,Daly M.J.,DeCaprio D.,Gnerre S.,Grabherr M.,Kellis M.,Kleber M.,Bardeleben C.,Goodstadt L.,Heger A.,Hitte C.,Kim L.,Koepfli K.-P.,Parker H.G.,Pollinger J.P.,Searle S.M.J.,Sutter N.B.,Thomas R.,Webber C.,Baldwin J.,Abebe A.,Abouelleil A.,Aftuck L.,Ait-Zahra M.,Aldredge T.,Allen N.,An P.,Anderson S.,Antoine C.,Arachchi H.,Aslam A.,Ayotte L.,Bachantsang P.,Barry A.,Bayul T.,Benamara M.,Berlin A.,Bessette D.,Blitshteyn B.,Bloom T.,Blye J.,Boguslavskiy L.,Bonnet C.,Boukhgalter B.,Brown A.,Cahill P.,Calixte N.,Camarata J.,Cheshatsang Y.,Chu J.,Citroen M.,Collymore A.,Cooke P.,Dawoe T.,Daza R.,Decktor K.,DeGray S.,Dhargay N.,Dooley K.,Dooley K.,Dorje P.,Dorjee K.,Dorris L.,Duffey N.,Dupes A.,Egbiremolen O.,Elong R.,Falk J.,Farina A.,Faro S.,Ferguson D.,Ferreira P.,Fisher S.,FitzGerald M.,Foley K.,Foley C.,Franke A.,Friedrich D.,Gage D.,Garber M.,Gearin G.,Giannoukos G.,Goode T.,Goyette A.,Graham J.,Grandbois E.,Gyaltsen K.,Hafez N.,Hagopian D.,Hagos B.,Hall J.,Healy C.,Hegarty R.,Honan T.,Horn A.,Houde N.,Hughes L.,Hunnicutt L.,Husby M.,Jester B.,Jones C.,Kamat A.,Kanga B.,Kells C.,Khazanovich D.,Kieu A.C.,Kisner P.,Kumar M.,Lance K.,Landers T.,Lara M.,Lee W.,Leger J.-P.,Lennon N.,Leuper L.,LeVine S.,Liu J.,Liu X.,Lokyitsang Y.,Lokyitsang T.,Lui A.,Macdonald J.,Major J.,Marabella R.,Maru K.,Matthews C.,McDonough S.,Mehta T.,Meldrim J.,Melnikov A.,Meneus L.,Mihalev A.,Mihova T.,Miller K.,Mittelman R.,Mlenga V.,Mulrain L.,Munson G.,Navidi A.,Naylor J.,Nguyen T.,Nguyen N.,Nguyen C.,Nguyen T.,Nicol R.,Norbu N.,Norbu C.,Novod N.,Nyima T.,Olandt P.,O'Neill B.,O'Neill K.,Osman S.,Oyono L.,Patti C.,Perrin D.,Phunkhang P.,Pierre F.,Priest M.,Rachupka A.,Raghuraman S.,Rameau R.,Ray V.,Raymond C.,Rege F.,Rise C.,Rogers J.,Rogov P.,Sahalie J.,Settipalli S.,Sharpe T.,Shea T.,Sheehan M.,Sherpa N.,Shi J.,Shih D.,Sloan J.,Smith C.,Sparrow T.,Stalker J.,Stange-Thomann N.,Stavropoulos S.,Stone C.,Stone S.,Sykes S.,Tchuinga P.,Tenzing P.,Tesfaye S.,Thoulutsang D.,Thoulutsang Y.,Topham K.,Topping I.,Tsamla T.,Vassiliev H.,Venkataraman V.,Vo A.,Wangchuk T.,Wangdi T.,Weiand M.,Wilkinson J.,Wilson A.,Yadav S.,Yang S.,Yang X.,Young G.,Yu Q.,Zainoun J.,Zembek L.,Zimmer A.,Lander E.S.
Genome sequence, comparative analysis and haplotype structure of the domestic dog.
Nature
438
803-819
2005
132024
Benbacer L.,Kut E.,Besnardeau L.,Laude H.,Delmas B.
Interspecies aminopeptidase-N chimeras reveal species-specific receptor recognition by canine coronavirus, feline infectious peritonitis virus, and transmissible gastroenteritis virus.
J. Virol.
71
734-737
1997