Sequence of AMPN_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
membrane alanyl aminopeptidase
P79098
Bos taurus
965
109276
Reaction
Release of an N-terminal amino acid, Xaa-/-Yaa- from a peptide, amide or arylamide. Xaa is preferably Ala, but may be most amino acids including Pro (slow action). When a terminal hydrophobic residue is followed by a prolyl residue, the two may be released as an intact Xaa-Pro dipeptide
Sequences with same EC No.
Sequence
show sequence in normal format
>P79098|membrane alanyl aminopeptidase|EC 3.4.11.2|Bos taurus|Swiss-Prot
MAKGFYISKALGILAILLGVAAVATIIALSVVYAQEKNKNAERGTAAPTSPTGPTTTSAT
TLDQSKPWNRYRLPTTLLPDSYRVTLRPYLTPNNNGLYIFTGSSTVRFTCKEPTDVIIIH
SKKLNYTQHSGHLAALKGVGDTQAPEIDRTELVLLTEYLVVHLKSSLEAGKTYEMETTFQ
GELADDLAGFYRSEYMDGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPKDL
TALSNMPPKGPSVPFDGDSNWSVTEFETTPVMSTYLLAYIVSEFTSVESVAPNDVQIRIW
ARPKATADNHGLYALNVTGPILNFFANHYNTAYPLPKSDQIALPDFNAGAMENWGLVTYR
ENALLYDPQSSSSSNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGAD
YAEPTWNLKDLMVPNDVYSVMAVDALVTSHPLTTPANEVNTPAQISEMFDTISYSKGASV
IRMLSNFLTEDLFKKGLASYLQTFAYQNTTYLNLWEHLQMAVENQLSIRLPDTVSAIMDR
WTLQMGFPVITVDTNTGTISQKHFLLDPNSTVTRPSQFNYLWIVPISSIRNGQPQEHYWL
RGEERNQNELFKAAADDWVLLNINVTGYYQVNYDENNWKKIQNQLMSRRENIPVINRAQV
IYDSFNLASAHMVPVTLALNNTLFLKNEMEYMPWQAAVSSLNYFKLMFDRTEVYGPMQNY
LKNQVEPIFLYFENLTKNWTEIPENLMDQYSEINAISTACSNGLPKCEELAKTLFNQWMN
NPNVNPIDPNLRSTIYCNAIAQGGQEEWDFAWNQLQQAELVNEADKLRSALACTNHVWLL
NRYLSYTLNPDLIRKQDATSTITSIASNVIGQSLAWDFIRSNWKKLFEDYGGGSFSFSNL
IQGVTRRFSTEFELQQLEEFKENNMDVGFGSGTRALEQALEKTKANINWVKENKEVVLNW
FKDHS
Download this sequence
in fasta format
Download all sequences for 3.4.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
132022
Benbacer L.,Kut E.,Besnardeau L.,Laude H.,Delmas B.
Interspecies aminopeptidase-N chimeras reveal species-specific receptor recognition by canine coronavirus, feline infectious peritonitis virus, and transmissible gastroenteritis virus.
J. Virol.
71
734-737
1997