Sequence of ASPD_BURP0

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aspartate dehydrogenase
A3P4L6
Burkholderia pseudomallei (strain 1106a)
271
27747
Reaction
L-aspartate + H2O + NAD(P)+ = oxaloacetate + NH3 + NAD(P)H + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A3P4L6|aspartate dehydrogenase|EC 1.4.1.21|Burkholderia pseudomallei (strain 1106a)|Swiss-Prot
MRNAHAPVDVAMIGFGAIGAAVYRAVEHDAALRVAHVIVPEHQCDAVRGALGERVDVVSS
VDALACRPQFALECAGHGALVDHVVPLLKAGTDCAVASIGALSDLALLDALSNAADAGGA
TLTLLSGAIGGIDALAAARQGGLDEVRYIGRKPPLGWLGTPAEAICDLRAMAAEQTIFEG
SARDAAQLYPRNANVAATVALAGVGLDATRVCLIADPAVTRNVHRIVARGAFGEMSIEMS
GKPLPDNPKTSALTAFSAIRALRNRASHCVI
Download this sequence
in fasta format
Download all sequences for 1.4.1.21
in fasta format
in csv (Excel, OpenOffice) format