Sequence of AGLB1_ARCFU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
dolichyl-phosphooligosaccharide-protein glycotransferase
O29918
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
591
67539
Reaction
an archaeal dolichyl phosphooligosaccharide + [protein]-L-asparagine = an archaeal dolichyl phosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine
Sequences with same EC No.
Sequence
show sequence in normal format
>O29918|dolichyl-phosphooligosaccharide-protein glycotransferase|EC 2.4.99.21|Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)|Swiss-Prot
MDRKVLMLAVILFALAVRFQNFGEIFDSGIYYTGYDSYYHMRLVEVMVKESFRPDYDYYI
NYPFGLKITWPPLFDYILAFPGMLFGFHSSEIFAVFLPVILGVLSVVLICLTALQIVNNQ
TFALISAFIYAAAPVAVWKTVLGQADHHALVIFLFLLSAYLLLKDGVWKILAGLPMLFMA
LAWLGSPIYGALLAFSALVHFDRKALRLVAASYLIPAISFVLYPPVGISFFGLAAFLFVG
SVVKGYEDRFRNATIYYIALSLATVLIIYFIPLPHFEFVKGGINYIFGANIYLPTISEAR
SLQIFEIISASGYIYFIFALISVLFFRNRFVLSMFFLSFILALMQLRFTEVLVVPSALLS
AYLVSLVLERLEYPVFEKADEEEKSRRRKRKDRKVKQKNAEVEWKDHAVVAAFLVILAIP
CIVVAVVPFDLTEDWKEALEWMRTSLEEQNYLNPYEKPEYSVMSWWDYGNWILYVSKKAV
VCNNFQAGAVDAAKFFTAKSEDEAIKIAKKRGVRYVVTADEITMKDANNTKFPAIMRIAG
YNVDLMTEGEILNFFNHTVLYRLHMENAENLTHFRLVKEFGDVKIFEVVGS
Download this sequence
in fasta format
Download all sequences for 2.4.99.21
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
130775
Klenk H.-P.,Clayton R.A.,Tomb J.-F.,White O.,Nelson K.E.,Ketchum K.A.,Dodson R.J.,Gwinn M.L.,Hickey E.K.,Peterson J.D.,Richardson D.L.,Kerlavage A.R.,Graham D.E.,Kyrpides N.C.,Fleischmann R.D.,Quackenbush J.,Lee N.H.,Sutton G.G.,Gill S.R.,Kirkness E.F.,Dougherty B.A.,McKenney K.,Adams M.D.,Loftus B.J.,Peterson S.N.,Reich C.I.,McNeil L.K.,Badger J.H.,Glodek A.,Zhou L.,Overbeek R.,Gocayne J.D.,Weidman J.F.,McDonald L.A.,Utterback T.R.,Cotton M.D.,Spriggs T.,Artiach P.,Kaine B.P.,Sykes S.M.,Sadow P.W.,D'Andrea K.P.,Bowman C.,Fujii C.,Garland S.A.,Mason T.M.,Olsen G.J.,Fraser C.M.,Smith H.O.,Woese C.R.,Venter J.C.
The complete genome sequence of the hyperthermophilic, sulphate-reducing archaeon Archaeoglobus fulgidus.
Nature
390
364-370
1997
130776
Taguchi Y.,Fujinami D.,Kohda D.
Comparative analysis of archaeal lipid-linked oligosaccharides that serve as oligosaccharide donors for Asn glycosylation.
J. Biol. Chem.
291
11042-11054
2016
130777
Matsumoto S.,Igura M.,Nyirenda J.,Matsumoto M.,Yuzawa S.,Noda N.,Inagaki F.,Kohda D.
Crystal structure of the C-terminal globular domain of oligosaccharyltransferase from Archaeoglobus fulgidus at 1.75 A resolution.
Biochemistry
51
4157-4166
2012