Sequence of A0A2P1B0T0_ACIBA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-lysine N6-monooxygenase (NADPH)
A0A2P1B0T0
Acinetobacter baumannii
477
54904
Reaction
L-lysine + NADPH + H+ + O2 = N6-hydroxy-L-lysine + NADP+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2P1B0T0|L-lysine N6-monooxygenase (NADPH)|EC 1.14.13.59|Acinetobacter baumannii|TrEMBL
MLDFIGIGLGPFNLSLASLLHDKSELQYRFFDQREKFDWHAGMQLPNAMLQVPFMADLVS
MVEPTSPFSFLNYLKHHQRLYKFYFRENLYIPRQEYNHYCQWVVEQLNHIEFSSRVLDIK
PIIGGFDVEVVCNGHHQHYRTRQLVLGVGTTPHLPESLQQIYLKSGTCLHSSEYLQYSSQ
KLSGNVVLIGSGQSAAEIFLDLFDRQYMNGRTTPDFHLYWLTRSAGFFPMENTPFGLEHF
SPDYMHYFYHLPSGLKAELPAQQANLYKGISSKTIRDIYERLYHRSIGGMPTDVTLAGHH
QLQYAELLENQKTKLCFEHRQQNKNYILEADCVIAATGYRYPNPKFIQNLQSLIIRDQAD
HWQVTSNFKVNYQGEGSIFIQNMEVYHHGVGTPDLGLGAYRAATIANQLVGEELFKLDHS
QSFQQFGVNASAQEEVSVRNIAASKITEFSRPLNKSELMHHSALGAYARSKLSEHIE
Download this sequence
in fasta format
Download all sequences for 1.14.13.59
in fasta format
in csv (Excel, OpenOffice) format