Sequence of AKSF_METJA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
homoisocitrate dehydrogenase
Q58991
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
347
38536
Reaction
(1R,2S)-1-hydroxybutane-1,2,4-tricarboxylate + NAD+ = 2-oxoadipate + CO2 + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q58991|homoisocitrate dehydrogenase|EC 1.1.1.87|Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)|Swiss-Prot
MMKVCVIEGDGIGKEVIPEAIKILNELGEFEIIKGEAGLECLKKYGNALPEDTIEKAKEA
DIILFGAITSPKPGEVKNYKSPIITLRKMFHLYANVRPINNFGIGQLIGKIADYEFLNAK
NIDIVIIRENTEDLYVGRERLENDTAIAERVITRKGSERIIRFAFEYAIKNNRKKVSCIH
KANVLRITDGLFLEVFNEIKKHYNIEADDYLVDSTAMNLIKHPEKFDVIVTTNMFGDILS
DEASALIGGLGLAPSANIGDDKALFEPVHGSAPDIAGKGIANPMASILSIAMLFDYIGEK
EKGDLIREAVKYCLINKKVTPDLGGDLKTKDVGDEILNYIRKKLKGY
Download this sequence
in fasta format
Download all sequences for 1.1.1.87
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
124180
Drevland R.M.,Jia Y.,Palmer D.R.J.,Graham D.E.
Methanogen homoaconitase catalyzes both hydrolyase reactions in coenzyme B biosynthesis.
J. Biol. Chem.
283
28888-28896
2008
124181
Bult C.J.,White O.,Olsen G.J.,Zhou L.,Fleischmann R.D.,Sutton G.G.,Blake J.A.,FitzGerald L.M.,Clayton R.A.,Gocayne J.D.,Kerlavage A.R.,Dougherty B.A.,Tomb J.-F.,Adams M.D.,Reich C.I.,Overbeek R.,Kirkness E.F.,Weinstock K.G.,Merrick J.M.,Glodek A.,Scott J.L.,Geoghagen N.S.M.,Weidman J.F.,Fuhrmann J.L.,Nguyen D.,Utterback T.R.,Kelley J.M.,Peterson J.D.,Sadow P.W.,Hanna M.C.,Cotton M.D.,Roberts K.M.,Hurst M.A.,Kaine B.P.,Borodovsky M.,Klenk H.-P.,Fraser C.M.,Smith H.O.,Woese C.R.,Venter J.C.
Complete genome sequence of the methanogenic archaeon, Methanococcus jannaschii.
Science
273
1058-1073
1996
124182
Howell D.M.,Graupner M.,Xu H.,White R.H.
Identification of enzymes homologous to isocitrate dehydrogenase that are involved in coenzyme B and leucine biosynthesis in methanoarchaea.
J. Bacteriol.
182
5013-5016
2000