Sequence of A0A3N0W5V5_9FLAO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
cystathionine gamma-synthase
A0A3N0W5V5
Chryseobacterium daecheongense
379
41164
Reaction
O4-succinyl-L-homoserine + L-cysteine = L-cystathionine + succinate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A3N0W5V5|cystathionine gamma-synthase|EC 2.5.1.48|Chryseobacterium daecheongense|TrEMBL
MNFNTKVIHGGQHHESATGSVNVPVFLTSTFAQKSPGVHSGYEYSRAANPTRQALEDSLA
SIENGARGLAFGSGLAAIDCVLKLLNPGDEVVAVDDLYGGTYRMFTRLFEKYQLKFTFVN
FDDVSKIADVITDKTKLIWVETPTNPLMKLVDIKAVVEIAKGKDILVAVDNTFATPYLQR
PIDLGADIVMHSATKYLGGHSDVIAGALVTKDAELGEKLHFIQFASGGILGPHDSYLVLR
GIKTLALRVQRHSENGMAVAKYLESHPAVAQVIYPGLESHPQYELAKSQMKDFGGMVSFT
FKSGKKEDAIKFLEKLKVFTLAESLGGVESLANHPALMTHASIPAEKRAELGITDDLVRL
SVGIEDAEDLIADLERAFS
Download this sequence
in fasta format
Download all sequences for 2.5.1.48
in fasta format
in csv (Excel, OpenOffice) format