Sequence of ACE2_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
angiotensin-converting enzyme 2
Q58DD0
Bos taurus
804
93067
Reaction
angiotensin II + H2O = angiotensin-(1-7) + L-phenylalanine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q58DD0|angiotensin-converting enzyme 2|EC 3.4.17.23|Bos taurus|Swiss-Prot
MTGSFWLLLSLVAVTAAQSTTEEQAKTFLEKFNHEAEDLSYQSSLASWNYNTNITDENVQ
KMNEARAKWSAFYEEQSRMAKTYSLEEIQNLTLKRQLKALQHSGTSALSAEKSKRLNTIL
NKMSTIYSTGKVLDPNTQECLALEPGLDDIMENSRDYNRRLWAWEGWRAEVGKQLRPLYE
EYVVLENEMARANNYEDYGDYWRGDYEVTGAGDYDYSRDQLMKDVERTFAEIKPLYEQLH
AYVRAKLMHTYPSYISPTGCLPAHLLGDMWGRFWTNLYSLTVPFEHKPSIDVTEKMENQS
WDAERIFKEAEKFFVSISLPYMTQGFWDNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMC
TKVTMDDFLTAHHEMGHIQYDMAYAAQPYLLRNGANEGFHEAVGEIMSLSAATPHYLKAL
GLLAPDFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKQQWMEKWWEMK
REIVGVVEPLPHDETYCDPACLFHVAEDYSFIRYYTRTIYQFQFHEALCKTAKHEGALFK
CDISNSTEAGQRLLQMLRLGKSEPWTLALENIVGIKTMDVKPLLNYFEPLFTWLKEQNRN
SFVGWSTEWTPYSDQSIKVRISLKSALGENAYEWNDNEMYLFQSSVAYAMRKYFSEARNE
TVLFGEDNVWVSDKKPRISFKFFVTSPNNVSDIIPRTEVENAIRLSRDRINDVFQLDDNS
LEFLGIQPTLGPPYEPPVTIWLIIFGVVMGVVVIGIVVLIFTGIRNRRKKNQASSEENPY
GSVDLNKGENNSGFQNIDDVQTSL
Download this sequence
in fasta format
Download all sequences for 3.4.17.23
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1116879
Harhay G.P.,Sonstegard T.S.,Keele J.W.,Heaton M.P.,Clawson M.L.,Snelling W.M.,Wiedmann R.T.,Van Tassell C.P.,Smith T.P.L.
Characterization of 954 bovine full-CDS cDNA sequences.
BMC Genomics
6
166-166
2005