Sequence of M4PV41_9POAL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
indole-3-glycerol-phosphate lyase
M4PV41
Zea nicaraguensis
341
35717
Reaction
(1S,2R)-1-C-(indol-3-yl)glycerol 3-phosphate = indole + D-glyceraldehyde 3-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>M4PV41|indole-3-glycerol-phosphate lyase|EC 4.1.2.8|Zea nicaraguensis|TrEMBL
MAFAPKTSSSSSSSLSSALQAAQSPPLVLRRTSSTATPRRRYDAAAVVTTTARAAAAAAA
VTVPAAPPAPKQAAAPAERRSRPVSDTMAALMAKGKTAFIPYITAGDPDLATTAEALRLL
DGCGADVIELGVPCSDPYIDGPIIQASVARALAGGTTMDAVLEMLREVTPALSCPVVLLS
YYKPIMSRSLAEMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTPAIPEDRMKE
ITKASEGFVYLVSVNGVTGPRANVNPRVESLIQEVKKVTNKPVAVGFGISKPEHVKQIAQ
WGADGVIIGSAMVRQLGEAASPKQGLRRLEEYARGMKNALP
Download this sequence
in fasta format
Download all sequences for 4.1.2.8
in fasta format
in csv (Excel, OpenOffice) format