Sequence of A0A0A7LCK2_9EURY

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tRNA (guanine6-N2)-methyltransferase
A0A0A7LCK2
Candidatus Methanoplasma termitum
279
31097
Reaction
S-adenosyl-L-methionine + guanine6 in tRNA = S-adenosyl-L-homocysteine + N2-methylguanine6 in tRNA
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0A7LCK2|tRNA (guanine6-N2)-methyltransferase|EC 2.1.1.256|Candidatus Methanoplasma termitum|TrEMBL
MSIILARYSEIGLKSTPVRVRFENRLKDNIMSMLAADRIEALVTKNDSRFYIESEDTDAA
VRTIRRVFGIASLSVTETCSSAMEDICSTAAKYSLNILKGGESFAVKARREGNQKYTSID
VGREAGSAIFLANESKNVRVKLTDPDVIFFIEVRNNKAYVFVTTVRGHAGLPLGTQGKVL
AEVKSERDVLSAWLMMKRGCKVIVRGDKQPLLERYDPEMKYGDVVSPDILGIVRGASLSD
LEQQDVTEYKIPLYFPTVGMSDEEVSLMLRTIKEEAFPS
Download this sequence
in fasta format
Download all sequences for 2.1.1.256
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
19773718
Lang K.,Schuldes J.,Klingl A.,Poehlein A.,Daniel R.,Brune A.
Comparative Genome Analysis of 'Candidatus Methanoplasma termitum' Indicates a New Mode of Energy Metabolism in the Seventh Order of Methanogens.
Appl. Environ. Microbiol.
0
0-0
2014