Sequence of MAZG_MYCS2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ATP diphosphatase
A0R3C4
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
324
35303
Reaction
ATP + H2O = AMP + diphosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0R3C4|ATP diphosphatase|EC 3.6.1.8|Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)|Swiss-Prot
MIVVLVDPRRPALVPVDAVEFLTGDVQYTEEMPVKVPWSLPSARPAYDGEDAPVLLSSDP
EHPVVKARLAAGDRLIAAPEPQPGERLVDAVALMDKLRTSGPWESEQTHDSLRRYLLEET
YELFDAVRSGNADELREELGDVLLQVLFHARIAEDAPHHPFSIDDVADALVRKLGNRVPA
VLAGESISLDEQLAQWEERKAQEKKVKARASSMDDVPTGQPALALAQKVLARVSQAGLPA
ELIPASLTSVSVSADTDSENELRTAVLEFMDTVREVEAAVAAGRRGEDVPEELDVAPLGV
ISEDEWRAYWPGAESSASEAEPEE
Download this sequence
in fasta format
Download all sequences for 3.6.1.8
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1032665
Deshayes C.,Perrodou E.,Gallien S.,Euphrasie D.,Schaeffer C.,Van-Dorsselaer A.,Poch O.,Lecompte O.,Reyrat J.-M.
Interrupted coding sequences in Mycobacterium smegmatis: authentic mutations or sequencing errors?
Genome Biol.
8
0-0
2007
1032666
Gallien S.,Perrodou E.,Carapito C.,Deshayes C.,Reyrat J.-M.,Van Dorsselaer A.,Poch O.,Schaeffer C.,Lecompte O.
Ortho-proteogenomics: multiple proteomes investigation through orthology and a new MS-based protocol.
Genome Res.
19
128-135
2009
1032667
Lu L.D.,Sun Q.,Fan X.Y.,Zhong Y.,Yao Y.F.,Zhao G.P.
Mycobacterial MazG is a novel NTP pyrophosphohydrolase involved in oxidative stress response.
J. Biol. Chem.
285
28076-28085
2010