Sequence of MAZG_ECO57

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ATP diphosphatase
P0AEY4
Escherichia coli O157:H7
263
30412
Reaction
ATP + H2O = AMP + diphosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>P0AEY4|ATP diphosphatase|EC 3.6.1.8|Escherichia coli O157:H7|Swiss-Prot
MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELG
DLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKT
EERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEA
RQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLE
MTGVDLETMEEVWQQVKRQEIDL
Download this sequence
in fasta format
Download all sequences for 3.6.1.8
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1032654
Perna N.T.,Plunkett G. III,Burland V.,Mau B.,Glasner J.D.,Rose D.J.,Mayhew G.F.,Evans P.S.,Gregor J.,Kirkpatrick H.A.,Posfai G.,Hackett J.,Klink S.,Boutin A.,Shao Y.,Miller L.,Grotbeck E.J.,Davis N.W.,Lim A.,Dimalanta E.T.,Potamousis K.,Apodaca J.,Anantharaman T.S.,Lin J.,Yen G.,Schwartz D.C.,Welch R.A.,Blattner F.R.
Genome sequence of enterohaemorrhagic Escherichia coli O157:H7.
Nature
409
529-533
2001
1032655
Hayashi T.,Makino K.,Ohnishi M.,Kurokawa K.,Ishii K.,Yokoyama K.,Han C.-G.,Ohtsubo E.,Nakayama K.,Murata T.,Tanaka M.,Tobe T.,Iida T.,Takami H.,Honda T.,Sasakawa C.,Ogasawara N.,Yasunaga T.,Kuhara S.,Shiba T.,Hattori M.,Shinagawa H.
Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12.
DNA Res.
8
11-22
2001