Sequence of HYKK_XENLA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
hydroxylysine kinase
Q6PB06
Xenopus laevis
374
42262
Reaction
GTP + 5-hydroxy-L-lysine = GDP + 5-phosphooxy-L-lysine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q6PB06|hydroxylysine kinase|EC 2.7.1.81|Xenopus laevis|Swiss-Prot
MAENKHIAALNNNKPALSEDQAVQLIESLYGVKVLNIKPLPSYDDQNFYIKSCSEDPNGC
CEYVMKITNSEDSRYGELLEAQTSVMVFLCSNGVPAQKPVFTKNGQSLSLETIDYGSTIQ
KQAVRLLTYLPGTPLARVVATPEILFDIGKMAANIDKMLAENFLHPNKTCFERGQFIWNL
SNTSLLRKYAHAVKETELQKIIEDVITQYETFVLPNLNCFRKCINHGDLNDHNILVEKTS
SPGSIQEQYKVSGILDFSDMSFGYYIFELAITIMYMMIESNDPLHAGGYVLAGFQSVIPL
TDEEKDALFFLVNCRFSQSLVMARYSVQLCPENEEYLMITAKTGWKHLQTLHDMGKEAVE
KIWFETADSYVATH
Download this sequence
in fasta format
Download all sequences for 2.7.1.81
in fasta format
in csv (Excel, OpenOffice) format