Sequence of A0A486KWD2_KLEPN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3-(methylthio)propionyl-CoA ligase
A0A486KWD2
Klebsiella pneumoniae
542
58997
Reaction
ATP + 3-(methylsulfanyl)propanoate + CoA = AMP + diphosphate + 3-(methylsulfanyl)propanoyl-CoA
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A486KWD2|3-(methylthio)propionyl-CoA ligase|EC 6.2.1.44|Klebsiella pneumoniae|TrEMBL
MPSPMIYQDLTTAALLGHAAQYHSETEIVSVSTGGEKERSCWGEVASRAQRLASALASLG
LPPGARCATLAWNNRRHLEIYFAVASGGWVTHTVNPRLSVDHLRYILNDAADEVLFFDQT
FLPLVAQLLPQLPTVKHVVLMESRSEAALSQLPSLLFYDDLLQQGMADYRWPQLNELTPA
SLCYTSGTTGRPKGVLNTHRSLVLHALSGNQPDAAGISAKDSLLPVVPMFHVNAWGTPFI
AAMVGARLVLPGPHLDGDSLLQLLAAEKVTVGFGVPVIWASLLAAMRRTEVRLPEFKRAL
VGGSALPPSMAEAFQRDYGIALTHAWGMTETSPIGTINTPLSKHDALPAQEQQKQRAGQG
RPIFGIELQVVDVDGEPLPRDGQSQGYLQVRGHWVVEQYYGQDASALTAAGWFDTGDIGT
LDANGYLVISDRAKDIIKSGGEWISTVELENIAIAHPGVRSAAAIAARHPRWDERPVLLC
VRAEGGEVEETDLLSWFEKRVPKWQIPDRVIFVDALPVSATGKVLKNQLRQAYGEILMSE
GK
Download this sequence
in fasta format
Download all sequences for 6.2.1.44
in fasta format
in csv (Excel, OpenOffice) format