Sequence of CARA_PECCC

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
carbapenam-3-carboxylate synthase
Q9XB61
Pectobacterium carotovorum subsp. carotovorum
503
55998
Reaction
ATP + (2S,5S)-5-carboxymethylproline = AMP + diphosphate + (3S,5S)-carbapenam 3-carboxylate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9XB61|carbapenam-3-carboxylate synthase|EC 6.3.3.6|Pectobacterium carotovorum subsp. carotovorum|Swiss-Prot
MSNSFCVVYKGSDTDINNIQRDFDGKGEALSNGYLFIEQNGHYQKCEMERGTAYLIGSLY
NRTFLIGLAGVWEGEAYLANDAELLALLFTRLGANALALAEGDFCFFIDEPNGELTVITE
SRGFSPVHVVQGKKAWMTNSLKLVTAAEGEGALWFEEEALVCQSLMRADTYTPVKNAQRL
KPGAVHVLTHDSEGYSFVESRTLTTPASNQLLALPREPLLALIDRYLNAPLEDLAPRFDT
VGIPLSGGLDSSLVTALASRHFKKLNTYSIGTELSNEFEFSQQVADALGTHHQMKILSET
EVINGIIESIYYNEIFDGLSAEIQSGLFNVYRQAQGQVSCMLTGYGSDLLFGGILKPGAQ
YDNPNQLLAEQVYRTRWTGEFATHGASCYGIDIRHPFWSHSLISLCHALHPDYKIFDNEV
KNILREYADSLQLLPKDIVWRKKIGIHEGSSVNQAFANVLGSTVDNYQTKSRFTYRVYQA
FLRGRLSITDVTPSQLKDLIKKD
Download this sequence
in fasta format
Download all sequences for 6.3.3.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
763101
McGowan S.J.,Sebaihia M.,O'Leary S.,Hardie K.R.,Williams P.,Stewart G.S.,Bycroft B.W.,Salmond G.P.
Analysis of the carbapenem gene cluster of Erwinia carotovora: definition of the antibiotic biosynthetic genes and evidence for a novel beta-lactam resistance mechanism.
Mol. Microbiol.
26
545-556
1997
763102
Gerratana B.,Stapon A.,Townsend C.A.
Inhibition and alternate substrate studies on the mechanism of carbapenam synthetase from Erwinia carotovora.
Biochemistry
42
7836-7847
2003
763103
Arnett S.O.,Gerratana B.,Townsend C.A.
Rate-limiting steps and role of active site Lys443 in the mechanism of carbapenam synthetase.
Biochemistry
46
9337-9345
2007
763104
Raber M.L.,Arnett S.O.,Townsend C.A.
A conserved tyrosyl-glutamyl catalytic dyad in evolutionarily linked enzymes: carbapenam synthetase and beta-lactam synthetase.
Biochemistry
48
4959-4971
2009
763105
Miller M.T.,Gerratana B.,Stapon A.,Townsend C.A.,Rosenzweig A.C.
Crystal structure of carbapenam synthetase (CarA).
J. Biol. Chem.
278
40996-41002
2003