Sequence of A0A1V6HPN0_9DELT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-erythro-3,5-diaminohexanoate dehydrogenase
A0A1V6HPN0
Deltaproteobacteria bacterium ADurb.Bin058
348
36547
Reaction
L-erythro-3,5-diaminohexanoate + H2O + NAD+ = (S)-5-amino-3-oxohexanoate + NH3 + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1V6HPN0|L-erythro-3,5-diaminohexanoate dehydrogenase|EC 1.4.1.11|Deltaproteobacteria bacterium ADurb.Bin058|TrEMBL
MANYPAGISFGTHRTIEPPGGLPQSAQRIDNSLPIHPTELLIDVEVLNIDAASFAQMRQA
ANDDPQGVADLIIETVNTRGKQHNPVTGSGGMLVGTVAQIGEDYHGPLKVKVGDKIATLV
SLSLTPLHLDKIHEVRMDLDQVAVSGHAILFSSGIAAVLPDDILRDVALAVLDVAGAPAQ
TARLVKPGMSVGILGTGKSGLLCAAVARQILGPKGRIIGIAHQPEFLKPSVELGYVDTPI
VVDARDPVAVLEEIHKATNGELLDLTLNTTNVPGTEMATVVATKNGGLAYYFNMATSFTA
AALGAEGIGKDVTLLIGNGYTPGHAELTLELLRQDPKLMEFFVERFAG
Download this sequence
in fasta format
Download all sequences for 1.4.1.11
in fasta format
in csv (Excel, OpenOffice) format