Sequence of A0A1R4LSY0_9VIBR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
carbapenam-3-carboxylate synthase
A0A1R4LSY0
Vibrio ruber DSM 16370
503
57153
Reaction
ATP + (2S,5S)-5-carboxymethylproline = AMP + diphosphate + (3S,5S)-carbapenam 3-carboxylate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1R4LSY0|carbapenam-3-carboxylate synthase|EC 6.3.3.6|Vibrio ruber DSM 16370|TrEMBL
METGFSLIKKSTANIEKKVENSFNCNTIPISDGILCVGKKEKYSQHNGESTIHLIGDIHN
LGFIHEFVSNLCSNANNLNPADIIMIMIKQLGFQSLSVLEGDFCIIMENNNLTCQVITNP
FGMNPVSIISSYDNHSLWITNNLKVFAAVEGDKAVHFKNPNLVCIDGPRENNFSPIHNAT
KLKPASINEISFDRKGYFYNKSSDLSFCSNHGETNFDEEHLLQIIDNYIKAPVSDSHNQY
KKVGIPLSGGLDSSLITLLASEQFDNIYTYSIGTESFNEFPYAEIVSECLHTTHENKVLD
EKDIIHGVIESIYYNEIFDGLSAEIQSGLFNVYKMANKNSELLLTGYGSDLLFGGVINPN
SQHDPNQELSQLVYRTQWTSEFSTLGPRELGIDIRHPFWTRRLISLCENMNHKLKIRDNE
NKYILRKYVDSFKKLPDEIVWRKKIGIHEGSAVDQSFANTLGVKVDNYYEKNLFTYKMYQ
SLILGRINIDDYNLDEIKKIITE
Download this sequence
in fasta format
Download all sequences for 6.3.3.6
in fasta format
in csv (Excel, OpenOffice) format