Sequence of A0A0F7IG24_9EURY

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tRNA (guanine6-N2)-methyltransferase
A0A0F7IG24
Geoglobus ahangari
367
42089
Reaction
S-adenosyl-L-methionine + guanine6 in tRNA = S-adenosyl-L-homocysteine + N2-methylguanine6 in tRNA
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0F7IG24|tRNA (guanine6-N2)-methyltransferase|EC 2.1.1.256|Geoglobus ahangari|TrEMBL
MKDVFYATCPPGLEFVAAGEIEGKRLGRVVEIREGKGRVFFRSSWQNVPRLNCLLRSVER
IVFLLGRERAEGLEDIYRIVRSIDFSFIRPEWSFAVRATRVGEHDFTSIDIGRVAGKAVI
DSYIEEKGVRLRVNLDEPDVIVRCDLIDDDFMVGIETTGDEGLHRRRYRVYQHPAPLNPV
LAASLVYLSGWSSTKSLLDPFCGSGTILFEAGMIARQIPICRFRKDFAFTRFFDSLPEVE
EKDVELRLYGIERFRKHLEGARTIADYTGIHPVFLEGLAERIEEHLERVDFIITNPPYGL
RIGKKKIIEDLYSGFLHSASKVLEEKAVVITAEREIFERYAEECFPDFLRYDVKYGGLLT
GVYVLKA
Download this sequence
in fasta format
Download all sequences for 2.1.1.256
in fasta format
in csv (Excel, OpenOffice) format