Sequence of MAZG_MYCTU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ATP diphosphatase
P96379
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
325
35413
Reaction
ATP + H2O = AMP + diphosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>P96379|ATP diphosphatase|EC 3.6.1.8|Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)|Swiss-Prot
MIVVLVDPRRPTLVPVEAIEFLRGEVQYTEEMPVAVPWSLPAARSAHAGNDAPVLLSSDP
NHPAVITRLAAGARLISAPDSQRGERLVDAVAMMDKLRTAGPWESEQTHDSLRRYLLEET
YELLDAVRSGSVDQLREELGDLLLQVLFHARIAEDASQSPFTIDDVADTLMRKLGNRAPG
VLAGESISLEDQLAQWEAAKASEKARKSVADDVHTGQPALALAQKVIQRAQKAGLPAHLI
PDEITSVSVSADVDAENTLRTAVLDFIDRLRCAERAIAVARRGSNVAEQLDVTPLGVITE
QEWLAHWPTAVNDSRGGSKKRKGMR
Download this sequence
in fasta format
Download all sequences for 3.6.1.8
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
682682
Cole S.T.,Brosch R.,Parkhill J.,Garnier T.,Churcher C.M.,Harris D.E.,Gordon S.V.,Eiglmeier K.,Gas S.,Barry C.E. III,Tekaia F.,Badcock K.,Basham D.,Brown D.,Chillingworth T.,Connor R.,Davies R.M.,Devlin K.,Feltwell T.,Gentles S.,Hamlin N.,Holroyd S.,Hornsby T.,Jagels K.,Krogh A.,McLean J.,Moule S.,Murphy L.D.,Oliver S.,Osborne J.,Quail M.A.,Rajandream M.A.,Rogers J.,Rutter S.,Seeger K.,Skelton S.,Squares S.,Squares R.,Sulston J.E.,Taylor K.,Whitehead S.,Barrell B.G.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
Nature
393
537-544
1998
682683
Lu L.D.,Sun Q.,Fan X.Y.,Zhong Y.,Yao Y.F.,Zhao G.P.
Mycobacterial MazG is a novel NTP pyrophosphohydrolase involved in oxidative stress response.
J. Biol. Chem.
285
28076-28085
2010
682684
Kelkar D.S.,Kumar D.,Kumar P.,Balakrishnan L.,Muthusamy B.,Yadav A.K.,Shrivastava P.,Marimuthu A.,Anand S.,Sundaram H.,Kingsbury R.,Harsha H.C.,Nair B.,Prasad T.S.,Chauhan D.S.,Katoch K.,Katoch V.M.,Kumar P.,Chaerkady R.,Ramachandran S.,Dash D.,Pandey A.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol. Cell. Proteomics
10
0-0
2011