Sequence of ODO1_RICPR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
oxoglutarate dehydrogenase (succinyl-transferring)
Q9ZDY3
Rickettsia prowazekii (strain Madrid E)
936
105796
Reaction
2-oxoglutarate + [dihydrolipoyllysine-residue succinyltransferase] lipoyllysine = [dihydrolipoyllysine-residue succinyltransferase] S-succinyldihydrolipoyllysine + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9ZDY3|oxoglutarate dehydrogenase (succinyl-transferring)|EC 1.2.4.2|Rickettsia prowazekii (strain Madrid E)|Swiss-Prot
MEEYFNKTGYLFSGNAVFVEELYRQYLANPNSVDQTWQEFFADIKDNNVVLNKSTAKVIS
TNVTNKELLNNNLSSETLNNLKAKEMISAYRRNAHYLANLDPLGLEIRKTKNDLKLNIEA
FGLDSSQLGENINIMDEFIGTWNCKLSELVTKLDKVYTSSIGVEFDQIENVEEKNWLYTK
LETDITFTSEEKKSILNDLVEVECFEQFLHIKFPGAKRFSIEGGDASIVAMNKAIDLSMH
QGVEEIVIGMAHRGRLNTLTKVVGKPYKEVIASFINGNIFPDGLNVSGDVKYHLGYSADR
VRANQKIHLSLADNPSHLEAINSIVAGKVRAKQDIFVDTKRSKIKAILVHGDAAFCGQGV
VAESLSMSPLTAYNVGGILHFVINNQLGFTANAADTRASRYSTEFAKIISAPILHVNGDD
IEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEGDEPMYTQSKMYNIIKSKPTPGSI
YANELVKNGIIDNNYYAKLKEKFKIRLDQEYEQAKSYKQETHFFEGYWKGISRIRGKDAI
TGVNKKILQDLGTKLCEIPKDFAINPKLIRLFEVRKTTLTTDQPIDWATAEQLAFAHLLC
SGINIRLTGQDSARGTFSHRHSILHNQIDDTTYIPLNNLSKTQAKYEVANSNLSEYAALG
FEYGYSLANPKNLVLWEAQFGDFANGAQIIFDQFISSSATKWLRMSGLVVLLPHAFEGQG
PEHSSARLERFLQLAAEENMYITYPTTPASIFHLLRRQILESTRKPLIVMSPKSLLRHKY
AVSKLDELGENTTFIPILDEVTKIDTNNVTKVILCSGKVYYDLFAMRTNNSNIVIIRLEQ
LYPFEKKLVASLLKKYNKAQAFIWCQEEPKNMGAWHYIATHLNDALKEAEINNEFKYVGR
EESASPAVGSLQVHNKQQEKLLMEALGDDIIKEKLY
Download this sequence
in fasta format
Download all sequences for 1.2.4.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
63988
Andersson S.G.E.,Zomorodipour A.,Andersson J.O.,Sicheritz-Ponten T.,Alsmark U.C.M.,Podowski R.M.,Naeslund A.K.,Eriksson A.-S.,Winkler H.H.,Kurland C.G.
The genome sequence of Rickettsia prowazekii and the origin of mitochondria.
Nature
396
133-140
1998