Sequence of ODO1_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
oxoglutarate dehydrogenase (succinyl-transferring)
Q5XI78
Rattus norvegicus
1023
116296
Reaction
2-oxoglutarate + [dihydrolipoyllysine-residue succinyltransferase] lipoyllysine = [dihydrolipoyllysine-residue succinyltransferase] S-succinyldihydrolipoyllysine + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5XI78|oxoglutarate dehydrogenase (succinyl-transferring)|EC 1.2.4.2|Rattus norvegicus|Swiss-Prot
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEE
MYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNV
DKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLHES
DLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFET
PGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSAN
GVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINR
VTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDP
EAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKY
AELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPR
SMTCPSTGLEEDILTHIGNVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMA
FGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSL
SEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLP
HGMEGMGPEHSSARPERFLQMCNDDPDVLPNLQEENFDISQLYDCNWIVVNCSTPGNFFH
VLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPEDGPAAQNPDKVKR
LLFCTGKVYYDLTRERKARDMAEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEH
KNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFK
KFS
Download this sequence
in fasta format
Download all sequences for 1.2.4.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
63983
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Genome Res.
14
2121-2127
2004