Sequence of PREA_SALTY

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
dihydropyrimidine dehydrogenase (NAD+)
Q8ZNL7
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
411
45079
Reaction
5,6-dihydrothymine + NAD+ = thymine + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q8ZNL7|dihydropyrimidine dehydrogenase (NAD+)|EC 1.3.1.1|Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)|Swiss-Prot
MLTKDLSVTFCGVKFPNPFCLSSSPVGNCYEMCAKAYDTGWGGIVFKTIGFFIANEVSPR
FDHLTKEDTGFIGFKNMEQIAEHPLEENLAAIRRLKQDYPDKVLIASIMGENEQQWQELA
RLVEEAGADMIECNFSCPQMTSHAMGSDVGQSPELVEKYCRAVKRGSSLPMLAKMTPNIG
DMCEVALAAKRGGADGIATINTVKSITNIDLNRKIGMPVVNGKSSISGYSGKAVKPIALR
FIQQLRMHPELRDFPISGIGGIETWEDAAEFLLLGAATLQVTTGIMQYGYRIVEDMASGL
SHYLADQGFASLQEMIGLANGNIIPAEDLDRSYIVYPRINQEKCVGCGRCYISCYDGGHQ
AMEWDEHSRTPHCNTEKCVGCLLCGHVCPVACIDLGEVKFKKGEKEHALTL
Download this sequence
in fasta format
Download all sequences for 1.3.1.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
575760
McClelland M.,Sanderson K.E.,Spieth J.,Clifton S.W.,Latreille P.,Courtney L.,Porwollik S.,Ali J.,Dante M.,Du F.,Hou S.,Layman D.,Leonard S.,Nguyen C.,Scott K.,Holmes A.,Grewal N.,Mulvaney E.,Ryan E.,Sun H.,Florea L.,Miller W.,Stoneking T.,Nhan M.,Waterston R.,Wilson R.K.
Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.
Nature
413
852-856
2001