Sequence of M1XLM2_NATM8

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tRNA (guanine6-N2)-methyltransferase
M1XLM2
Natronomonas moolapensis (strain DSM 18674 / JCM 14361 / 8.8.11)
383
41514
Reaction
S-adenosyl-L-methionine + guanine6 in tRNA = S-adenosyl-L-homocysteine + N2-methylguanine6 in tRNA
Sequences with same EC No.
Sequence
show sequence in normal format
>M1XLM2|tRNA (guanine6-N2)-methyltransferase|EC 2.1.1.256|Natronomonas moolapensis (strain DSM 18674 / JCM 14361 / 8.8.11)|TrEMBL
MHLLATTNGGLESVAAGEIDDLVGRDASIHHRGVVEFDGDVEDVYDLHYRGRTLHRIMAV
LADGVVEELADVYELTASAPVEARLPSSDFGVVGTRHGDHEFTSVDVAERVGQAVIDAYR
DAAGTRLPVDLDDPTVKLEAYLYDDRFTLAVDLTGESLHKRPYRICEHDAPVRGTLAYAM
LRIAGWTPTDRLVDPMAGSATIPTEAALAATGAVPRPDLEPSFGALPGYDVDRFRRRRDA
YADPPSGPGTTRGGSPADRPSTGGALDASALDIEAREIRSRWRRCARVNREAAGLEDAFD
VVDADAREASIDADRVVTNLPFGVRTGTDLRELYGAFVDRLEAGDIGRLVALTTSPELLP
VEPTERYNIPYGRLDAAIVVWEP
Download this sequence
in fasta format
Download all sequences for 2.1.1.256
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
105109419
Dyall-Smith M.L.,Pfeiffer F.,Oberwinkler T.,Klee K.,Rampp M.,Palm P.,Gross K.,Schuster S.C.,Oesterhelt D.
Genome of the haloarchaeon Natronomonas moolapensis, a neutrophilic member of a previously haloalkaliphilic genus.
Genome Announc.
1
0-0
2013