Sequence of J0SP44_9ACTO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
S-ribosylhomocysteine lyase
J0SP44
Actinomyces sp. ICM47
141
15642
Reaction
S-(5-deoxy-D-ribos-5-yl)-L-homocysteine = L-homocysteine + (4S)-4,5-dihydroxypentan-2,3-dione
Sequences with same EC No.
Sequence
show sequence in normal format
>J0SP44|S-ribosylhomocysteine lyase|EC 4.4.1.21|Actinomyces sp. ICM47|TrEMBL
MRLINVEAGPKGDQISNFDVRFVQPNSGEIPSSGLHTIEHLLASLLRDRIDGVIDCSPFG
CRTGFHLIMWGTPCVKEVTAAIASSLHAIAEEATWEDVPGTDVYSCGNYRDHSLFSAREW
SRTILEQGLSIDPFERVFIVH
Download this sequence
in fasta format
Download all sequences for 4.4.1.21
in fasta format
in csv (Excel, OpenOffice) format