Sequence of MBTG_MYCPA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-lysine N6-monooxygenase (NADPH)
Q73XY8
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
428
46532
Reaction
L-lysine + NADPH + H+ + O2 = N6-hydroxy-L-lysine + NADP+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>Q73XY8|L-lysine N6-monooxygenase (NADPH)|EC 1.14.13.59|Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)|Swiss-Prot
MSTLAILGAGAKAVAVAAKASVLRDMGVEVPDVVAVERIGVAANWQASGGWTDGAHRLGT
SPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATASFAEWIDRGRPAPTHRRWSQY
LSWVADHVGMTVVHGEVEQLAVTGDRWALHTHETTVHADALMITGPGQAEKSLLPGNPRM
LSIAQFWDRAANHDRISAERVAVIGGGETAAAMLNELFRHRVSSITVISPQATLFTRGEG
YFENSLFSDPTNWPALTLAERRDALARTDRGVFSSSVQEALLADDRIHHLRGRVTHAVGV
QGQIRLTLSTNRGSENLETVHGFDLVIDGSGADSLWFAPLFSQEALDLLELGLGGPLSSE
RLQEAIGYDLAVTDVTPKLFLPNLSGLTQGPGFPNLSCLGLLSDRVLGSTLGPTNYPARR
RHDERQPL
Download this sequence
in fasta format
Download all sequences for 1.14.13.59
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
556412
Li L.,Bannantine J.P.,Zhang Q.,Amonsin A.,May B.J.,Alt D.,Banerji N.,Kanjilal S.,Kapur V.
The complete genome sequence of Mycobacterium avium subspecies paratuberculosis.
Proc. Natl. Acad. Sci. U.S.A.
102
12344-12349
2005