Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Cloned(Commentary)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 11 > >>
EC Number Cloned (Commentary) Reference
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244gene EEF1AKMT1, sequence comparisons, recombinant expression of N-terminally His6-tagged enzyme in Escherichia coli strain Rosetta DE3 757664
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244gene EFM5, sequence comparisons, recombinant expression of N-terminally His6-tagged enzyme in Escherichia coli strain Rosetta DE3 757664
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244gene EFM7, sequence comparisons, recombinant expression of N-terminally His6-tagged enzyme in Escherichia coli strain Rosetta DE3 757664
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244gene METTL11A 717248
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244gene METTL11A, cloning of the His-tagged human enzyme using vector pET-100/DTOPO that carries a His6 tag in the linker region MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFT, which is incorporated before the initiator methionine residue of the cloned protein, and expression in Escherichia coli strain BL21(DE3) 717248
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244gene NTMT1, recombinant expression of His-tagged NRMT1 in Escherichia coli and of FLAG-tagged wild-type and mutant NRMT1s in HEK-293 cells, recombinant expression of GFP-tagged enzyme in HCT-116 cells 758296
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244generbcMTS, DNA and amino acid sequence determination and analysis, expression of a N-terminal truncated form of spinach SSMT in Escherichia coli 717021
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244N-terminally tagged FLAG-NRMT overexpression in HEK 293LT cell nuceli, that show 3fold increased RCC1 alpha-N-methyltransferase activity 718160
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244recombinant expression of His-tagged enzyme in Escherichia coli strain BL21-CodonPlus(DE3)-RIL 757405
Display the word mapDisplay the reaction diagram Show all sequences 2.1.1.244recombinant expression of His-tagged wild-type and mutant enzymes in Escherichia coli 756877
Results 1 - 10 of 11 > >>