Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 29 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42Bovine insulin B-chain + H2O the preferential peptide bonds hydrolyzed are: Phe-Phe, Tyr-Leu, Phe-Tyr, Leu-Val and Tyr-Thr Saccharolobus solfataricus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42Bovine insulin B-chain + H2O the preferential peptide bonds hydrolyzed are: Phe-Phe, Tyr-Leu, Phe-Tyr, Leu-Val and Tyr-Thr Saccharolobus solfataricus P2 ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42Bovine serum albumin + H2O - Sulfolobus acidocaldarius ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42carbonic anhydrase + H2O - Sulfolobus acidocaldarius ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42chicken egg albumin + H2O - Sulfolobus acidocaldarius ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O substrate insulin B chain Sulfolobus acidocaldarius FVNQHLCGSHL + VEAL + YLVCGERGF + L-Phe + YTPKA - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42glyceraldehyde-3-phosphate dehydrogenase + H2O - Sulfolobus acidocaldarius ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42Hemoglobin + H2O - Sulfolobus acidocaldarius ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42Hemoglobin + H2O - Saccharolobus solfataricus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.42Hemoglobin + H2O the preferential peptide bonds hydrolyzed are: Phe-Phe, Tyr-Leu, Phe-Tyr, Leu-Val and Tyr-Thr Saccharolobus solfataricus ? - ?
Results 1 - 10 of 29 > >>