Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 14 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30angiotensin + H2O formerly designated angiotensin II, hydrolysis of Tyr4-Ile5 Trametes sanguinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30angiotensin + H2O cleavage at Tyr4-Ile5, at pH 2.7 Trametes coccinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser + H2O cleavage of Tyr-Ile and Leu-Val Trametes sanguinea Asp-Arg-Val-Tyr + Ile-His-Pro-Phe-His-Leu-Leu + Val-Tyr-Ser - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30casein + H2O - Trametes coccinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O i.e. oxidized insulin B chain, cleavage site specificity of isozymes Ia and Ib at pH 2.7, overview Trametes coccinea FVNQHLCGSHLVEA + Leu-Val + LVCGERGF + FYTPKA - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30Hemoglobin + H2O - Trametes coccinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30more not: oxidized insulin peptide B15-B24, peptide bonds which have a hydrophobic amino acid in the P1' position are preferentially cleaved Trametes sanguinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30more the extracellular enzyme is involved in fungal nutrition from wood Trametes coccinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30more cleavage site specificity of the isoymes, no activity with isulin A chain, overview Trametes coccinea ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.30Native insulin + H2O Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed Trametes sanguinea Hydrolyzed insulin - ?
Results 1 - 10 of 14 > >>