Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 89 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82aggrecan + H2O - Bos taurus fragments of aggrecan - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82aggrecan + H2O Glu373-Ala374 is the major cleavage site, aggrecanase also cleaves at Glu1971-Leu1972, which is located in the gap region in the chondroitin sulfate attachment region, aggrecanase does not cleave at the matrix metalloproteinase site Asn341-Phe342 Bos taurus fragments of aggrecan - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82aggrecan + H2O cleaves the Glu373-Ala374 bond Bos taurus fragments of aggrecan - ir
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82brevican + H2O - Bos taurus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82N-procollagen + H2O - Bos taurus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82QTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLK + H2O - Bos taurus QTVTWPDMELPLPRNITEGE + ARGSVILTVKPIFEVSPSPLK - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82recombinant Agg1 + H2O - Bos taurus fragments of recombinant Agg1 - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican-1 + H2O - Bos taurus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican-2 + H2O - Bos taurus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.825-carboxyfluorescein-Ala-Glu-Leu-Gln-Gly-Arg-Pro-Ile-Ser-Ile-Ala-Lys-N,N,N',N'-tetramethyl-6-carboxyrhodamine + H2O - Homo sapiens 5-carboxyfluorescein-Ala-Glu + Leu-Gln-Gly-Arg-Pro-Ile-Ser-Ile-Ala-Lys-N,N,N',N'-tetramethyl-6-carboxyrhodamine - ?
Results 1 - 10 of 89 > >>