Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

<< < Results 81 - 89 of 89
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican + H2O - Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican + H2O - Mus musculus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican V1 + H2O - Homo sapiens fragments of versican V1 - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican V2 + H2O - Homo sapiens glial hyaluronate binding protein + ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican-1 + H2O - Bos taurus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82versican-2 + H2O - Bos taurus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82[protein fragment, 43 aa] + H2O - Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82[protein fragment, 43 aa] + H2O 43mer peptide substrate Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.82[C6-(Gly-Pro-Hyp)5-Gly-Thr-Lys(7-amido-4-methylcoumarin)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(2,4-dinitrophenyl)-Gly-Ile-Ser-(Gly-Pro-Hyp)5-NH2]3 + H2O - Homo sapiens ? - ?
<< < Results 81 - 89 of 89